Protein Folding with Pyrosetta

In this tutorial, we will fold a protein structure using a very simple algorithm in PyRosetta, and compare the folded structure with the solved crystal structure of the protein.

Importing relevant libraries

We begin by importing the relevant libraries from Python. If running the following cell produces any errors or warnings, make sure you have followed all the steps in the "Setting up Pyrosetta" section.

In [22]:
import os
import glob
import shutil
import pandas as pd
import nglview as ngl
import pyrosetta as prs
prs.init()
from pyrosetta import rosetta

PyRosetta-4 2020 [Rosetta PyRosetta4.conda.linux.CentOS.python37.Release 2020.08+release.cb1cabafd7463ab703f6abf5efa33d2707b85924 2020-02-20T07:29:09] retrieved from: http://www.pyrosetta.org
(C) Copyright Rosetta Commons Member Institutions. Created in JHU by Sergey Lyskov and PyRosetta Team.
core.init: {0} Checking for fconfig files in pwd and ./rosetta/flags
core.init: {0} Rosetta version: PyRosetta4.conda.linux.CentOS.python37.Release r247 2020.08+release.cb1caba cb1cabafd7463ab703f6abf5efa33d2707b85924 http://www.pyrosetta.org 2020-02-20T07:29:09
core.init: {0} command: PyRosetta -ex1 -ex2aro -database /home/tommysmith176/anaconda3/lib/python3.7/site-packages/pyrosetta/database
basic.random.init_random_generator: {0} 'RNG device' seed mode, using '/dev/urandom', seed=1854151119 seed_offset=0 real_seed=1854151119 thread_index=0
basic.random.init_random_generator: {0} RandomGenerator:init: Normal mode, seed=1854151119 RG_type=mt19937

Setting up score functions that will be used across parts

In [23]:
scorefxn_low = prs.create_score_function('score3')
scorefxn_high = prs.get_fa_scorefxn()

core.scoring.ScoreFunctionFactory: {0} SCOREFUNCTION: ref2015

Loading the native (solved crystal) structure

In [25]:
native_pose = prs.pose_from_pdb('data/1BL0/1BL0_chainA.pdb')

core.import_pose.import_pose: {0} File 'data/1BL0/1BL0_chainA.pdb' automatically determined to be of type PDB

We can check the amino acid sequence of the structure with a very simple command.

In [32]:
native_pose.sequence()
Out[32]:
'DAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPL'

We can also assign the correct secondary structure.

In [39]:
DSSP = prs.rosetta.protocols.moves.DsspMover()
DSSP.apply(native_pose)    # populates the pose's Pose.secstruct

protocols.DsspMover: {0} LHHHHHHHHHHHHLLLLLLLLLHHHHHHLLLLHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHHHHHLLLLHHHHHHHHLLLLHHHHHHHHHHHHLLLHHHHHLLLLLLLLLLLLLL

Hint: The amino acids are also called residues!

Let's view more information about the first residue of the protein.

In [91]:
print(native_pose.residue(1))

Residue 1: ASP:NtermProteinFull (ASP, D):
Base: ASP
 Properties: POLYMER PROTEIN CANONICAL_AA LOWER_TERMINUS SC_ORBITALS POLAR CHARGED NEGATIVE_CHARGE METALBINDING ALPHA_AA L_AA
 Variant types: LOWER_TERMINUS_VARIANT
 Main-chain atoms:  N    CA   C  
 Backbone atoms:    N    CA   C    O   1H   2H   3H    HA 
 Side-chain atoms:  CB   CG   OD1  OD2 1HB  2HB 
Atom Coordinates:
   N  : 0.229, 36.012, 74.172
   CA : 0.041, 35.606, 75.594
   C  : -0.096, 36.849, 76.498
   O  : -0.951, 36.895, 77.382
   CB : 1.225, 34.718, 76.092
   CG : 2.159, 34.156, 74.999
   OD1: 1.688, 33.361, 74.151
   OD2: 3.378, 34.497, 75.007
  1H  : 1.056, 35.74, 73.68
  2H  : -0.43, 35.723, 73.478
  3H  : 0.251, 36.981, 73.928
   HA : -0.884, 35.037, 75.696
  1HB : 1.839, 35.199, 76.854
  2HB : 0.67, 33.892, 76.539
Mirrored relative to coordinates in ResidueType: FALSE
In [92]:
pose = prs.pose_from_sequence(native_pose.sequence())
test_pose = prs.Pose()
test_pose.assign(pose)
test_pose.pdb_info().name('Linearized Pose')
In [93]:
view = ngl.show_rosetta(test_pose)
view.add_ball_and_stick()
view  # zoom in to see the atoms!

Defining movers to switch from full-atom to centroid representation

We will be using the centroid representation to perform rough and fast scoring in the initial stages of the folding algorithm. Later on, we will switch to the full atom represenation to do accurate minimization and get the final structures.

In [71]:
to_centroid = prs.SwitchResidueTypeSetMover('centroid')
to_full_atom = prs.SwitchResidueTypeSetMover('fa_standard')
In [73]:
to_full_atom.apply(test_pose)
print('Full Atom Score:', scorefxn_high(test_pose))
to_centroid.apply(test_pose)
print('Centroid Score:', scorefxn_low(test_pose))

Full Atom Score: 46414.5467132469
Centroid Score: 454.1228630783549

Q: Visualize the centroid-only structure and see the difference with the full atom that we visualized above? Print again the information for the first residue and compare.

In [129]:
# here write the code to visualize the centroid only structure and print the information of the 1st residue

to_centroid = prs.SwitchResidueTypeSetMover('centroid')
to_centroid.apply(test_pose)
print('Centroid Score:', scorefxn_low(test_pose))


view = ngl.show_rosetta(test_pose)
view.add_ball_and_stick()
view  # zoom in to see the atoms!

#test_pose.is_centroid()

core.util.switchresiduetypeset: {0} [ WARNING ] When switching to a centroid ResidueTypeSet:  Pose already contains centroid ResidueTypes.
Centroid Score: 454.1228630783549

Setting up the folding algorithm

In [94]:
# Loading the files with the pre-computed fragmets
long_frag_filename = 'data/1BL0/9_fragments.txt'
long_frag_length = 9
short_frag_filename = 'data/1BL0/3_fragments.txt'
short_frag_length = 3

# Defining parameters of the folding algorithm
long_inserts=5  # How many 9-fragment pieces to insest during the search
short_inserts=10 # How many 3-fragment pieces to insest during the search

kT = 3.0 # Simulated Annealing temperature
cycles = 1000 # How many cycles of Monte Carlo search to run
jobs = 50 # How many trajectories in parallel to compute.
job_output = 'outputs/1BL0/decoy' # The prefix of the filenames to store the results

Loading the fragmets

In [113]:
movemap = prs.MoveMap()
movemap.set_bb(True)

fragset_long = rosetta.core.fragment.ConstantLengthFragSet(long_frag_length, long_frag_filename)
long_frag_mover = rosetta.protocols.simple_moves.ClassicFragmentMover(fragset_long, movemap)

fragset_short = rosetta.core.fragment.ConstantLengthFragSet(short_frag_length, short_frag_filename)
short_frag_mover = rosetta.protocols.simple_moves.ClassicFragmentMover(fragset_short, movemap)

insert_long_frag = prs.RepeatMover(long_frag_mover, long_inserts)
insert_short_frag = prs.RepeatMover(short_frag_mover, short_inserts)

core.fragments.ConstantLengthFragSet: {0} finished reading top 200 9mer fragments from file data/1BL0/9_fragments.txt
core.fragments.ConstantLengthFragSet: {0} finished reading top 200 3mer fragments from file data/1BL0/3_fragments.txt

Q: How many 9-mer and 3-mer fragmets do we have in our database?

In [ ]:
200 of each?
In [96]:
# Making sure the structure is in centroid-only mode for the search
test_pose.assign(pose)
to_centroid.apply(test_pose)
In [97]:
# Defining what sequence of actions to do between each scoring step
folding_mover = prs.SequenceMover()
folding_mover.add_mover(insert_long_frag)
folding_mover.add_mover(insert_short_frag)
In [98]:
mc = prs.MonteCarlo(test_pose, scorefxn_low, kT)
trial = prs.TrialMover(folding_mover, mc)
In [99]:
# Setting up how many cycles of search to do in each trajectory
folding = prs.RepeatMover(trial, cycles)

Setting up the relax mover for the final stage

In [100]:
fast_relax_mover = prs.rosetta.protocols.relax.FastRelax(scorefxn_high)

protocols.relax.RelaxScriptManager: {0} Reading relax scripts list from database.
protocols.relax.RelaxScriptManager: {0} Looking for MonomerRelax2019.txt
protocols.relax.RelaxScriptManager: {0} ================== Reading script file: /home/tommysmith176/anaconda3/lib/python3.7/site-packages/pyrosetta/database/sampling/relax_scripts/MonomerRelax2019.txt ==================
protocols.relax.RelaxScriptManager: {0} repeat %%nrepeats%%
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 1.0
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.040
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.051
protocols.relax.RelaxScriptManager: {0} min 0.01
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 0.5
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.265
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.280
protocols.relax.RelaxScriptManager: {0} min 0.01
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 0.0
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.559
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.581
protocols.relax.RelaxScriptManager: {0} min 0.01
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 0.0
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 1
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} min 0.00001
protocols.relax.RelaxScriptManager: {0} accept_to_best
protocols.relax.RelaxScriptManager: {0} endrepeat

Running the folding algorithm!

In [101]:
scores = [0] * (jobs + 1)
scores[0] = scorefxn_low(test_pose)
In [102]:
if os.path.isdir(os.path.dirname(job_output)):
    shutil.rmtree(os.path.dirname(job_output), ignore_errors=True)
os.makedirs(os.path.dirname(job_output))
jd = prs.PyJobDistributor(job_output, nstruct=jobs, scorefxn=scorefxn_high)

Working on decoy: outputs/1BL0/decoy_40.pdb
In [103]:
counter = 0 
while not jd.job_complete:
    # a. set necessary variables for the new trajectory
    # -reload the starting pose
    test_pose.assign(pose)
    to_centroid.apply(test_pose)
    # -change the pose's PDBInfo.name, for the PyMOL_Observer
    counter += 1
    test_pose.pdb_info().name(job_output + '_' + str(counter))
    # -reset the MonteCarlo object (sets lowest_score to that of test_pose)
    mc.reset(test_pose)

    #### if you create a custom protocol, you may have additional
    ####    variables to reset, such as kT

    #### if you create a custom protocol, this section will most likely
    ####    change, many protocols exist as single Movers or can be
    ####    chained together in a sequence (see above) so you need
    ####    only apply the final Mover
    # b. apply the refinement protocol
    folding.apply(test_pose)

    ####
    # c. export the lowest scoring decoy structure for this trajectory
    # -recover the lowest scoring decoy structure
    mc.recover_low(test_pose)
    # -store the final score for this trajectory
    # -convert the decoy to fullatom
    # the sidechain conformations will all be default,
    #    normally, the decoys would NOT be converted to fullatom before
    #    writing them to PDB (since a large number of trajectories would
    #    be considered and their fullatom score are unnecessary)
    # here the fullatom mode is reproduced to make the output easier to
    #    understand and manipulate, PyRosetta can load in PDB files of
    #    centroid structures, however you must convert to fullatom for
    #    nearly any other application
    to_full_atom.apply(test_pose)
    fast_relax_mover.apply(test_pose)
    scores[counter] = scorefxn_high(test_pose)
    # -output the fullatom decoy structure into a PDB file
    jd.output_decoy(test_pose)
    # -export the final structure to PyMOL
    test_pose.pdb_info().name(job_output + '_' + str(counter) + '_fa')

protocols.relax.FastRelax: {0} CMD: repeat  70635.1  0  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70635.1  0  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6927.96  0  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2543 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
basic.thread_manager.RosettaThreadManager: {?} Creating a thread pool of 8 threads.
basic.thread_manager.RosettaThread: {?} Launching thread 1.
basic.thread_manager.RosettaThread: {?} Launching thread 2.
basic.thread_manager.RosettaThread: {?} Launching thread 4.
basic.random.init_random_generator: {?} 'RNG device' seed mode, using '/dev/urandom', seed=-2118247730 seed_offset=0 real_seed=-2118247729 thread_index=1
basic.random.init_random_generator: {?} RandomGenerator:init: Normal mode, seed=-2118247729 RG_type=mt19937
basic.thread_manager.RosettaThreadPool: {?} Launched 7 new threads.
basic.random.init_random_generator: {2} 'RNG device' seed mode, using '/dev/urandom', seed=-1538245069 seed_offset=0 real_seed=-1538245067 thread_index=2
basic.random.init_random_generator: {2} RandomGenerator:init: Normal mode, seed=-1538245067 RG_type=mt19937
basic.thread_manager.RosettaThread: {5} Launching thread 5.
basic.thread_manager.RosettaThread: {7} Launching thread 7.
basic.thread_manager.RosettaThread: {3} Launching thread 3.
basic.random.init_random_generator: {4} 'RNG device' seed mode, using '/dev/urandom', seed=1264395913 seed_offset=0 real_seed=1264395917 thread_index=4
basic.random.init_random_generator: {4} RandomGenerator:init: Normal mode, seed=1264395917 RG_type=mt19937
basic.thread_manager.RosettaThread: {6} Launching thread 6.
basic.random.init_random_generator: {3} 'RNG device' seed mode, using '/dev/urandom', seed=1371921218 seed_offset=0 real_seed=1371921221 thread_index=3
basic.random.init_random_generator: {3} RandomGenerator:init: Normal mode, seed=1371921221 RG_type=mt19937
basic.random.init_random_generator: {7} 'RNG device' seed mode, using '/dev/urandom', seed=1713933009 seed_offset=0 real_seed=1713933016 thread_index=7
basic.random.init_random_generator: {7} RandomGenerator:init: Normal mode, seed=1713933016 RG_type=mt19937
basic.random.init_random_generator: {5} 'RNG device' seed mode, using '/dev/urandom', seed=-503396849 seed_offset=0 real_seed=-503396844 thread_index=5
basic.random.init_random_generator: {5} RandomGenerator:init: Normal mode, seed=-503396844 RG_type=mt19937
basic.random.init_random_generator: {6} 'RNG device' seed mode, using '/dev/urandom', seed=2140042929 seed_offset=0 real_seed=2140042935 thread_index=6
basic.random.init_random_generator: {6} RandomGenerator:init: Normal mode, seed=2140042935 RG_type=mt19937
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -86.34  0  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -67.3139  0  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -250.165  3.04404  3.04404  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.165  3.04404  3.04404  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -123.599  3.04404  3.04404  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2860 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -147.491  3.04404  3.04404  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.695  3.04404  3.04404  0.154
protocols.relax.FastRelax: {0} CMD: min  -213.591  2.84712  2.84712  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.591  2.84712  2.84712  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.616  2.84712  2.84712  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2663 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -172.542  2.84712  2.84712  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.185  2.84712  2.84712  0.31955
protocols.relax.FastRelax: {0} CMD: min  -188.283  3.06803  3.06803  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -188.283  3.06803  3.06803  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -148.133  3.06803  3.06803  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2471 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -148.699  3.06803  3.06803  0.55
protocols.relax.FastRelax: {0} CMD: min  -197.669  3.69392  3.69392  0.55
protocols.relax.FastRelax: {0} MRP: 0  -197.669  -197.669  3.69392  3.69392
protocols.relax.FastRelax: {0} CMD: accept_to_best  -197.669  3.69392  3.69392  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -197.669  3.69392  3.69392  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.669  3.69392  3.69392  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.68  3.69392  3.69392  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2629 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.956  3.69392  3.69392  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -268.007  3.69392  3.69392  0.02805
protocols.relax.FastRelax: {0} CMD: min  -311.885  4.20664  4.20664  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.885  4.20664  4.20664  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.655  4.20664  4.20664  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3038 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.099  4.20664  4.20664  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.5  4.20664  4.20664  0.154
protocols.relax.FastRelax: {0} CMD: min  -258.277  3.98187  3.98187  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.277  3.98187  3.98187  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.989  3.98187  3.98187  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2794 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.818  3.98187  3.98187  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.868  3.98187  3.98187  0.31955
protocols.relax.FastRelax: {0} CMD: min  -225.448  3.79419  3.79419  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.448  3.79419  3.79419  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.845  3.79419  3.79419  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2653 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.379  3.79419  3.79419  0.55
protocols.relax.FastRelax: {0} CMD: min  -203.413  3.68211  3.68211  0.55
protocols.relax.FastRelax: {0} MRP: 1  -203.413  -203.413  3.68211  3.68211
protocols.relax.FastRelax: {0} CMD: accept_to_best  -203.413  3.68211  3.68211  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -203.413  3.68211  3.68211  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -203.413  3.68211  3.68211  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.518  3.68211  3.68211  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2902 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -274.589  3.68211  3.68211  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.803  3.68211  3.68211  0.02805
protocols.relax.FastRelax: {0} CMD: min  -303.569  4.34817  4.34817  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -303.569  4.34817  4.34817  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.866  4.34817  4.34817  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3005 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.854  4.34817  4.34817  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.428  4.34817  4.34817  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.854  3.80385  3.80385  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.854  3.80385  3.80385  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.634  3.80385  3.80385  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2716 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.832  3.80385  3.80385  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.998  3.80385  3.80385  0.31955
protocols.relax.FastRelax: {0} CMD: min  -227.591  3.57757  3.57757  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -227.591  3.57757  3.57757  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.764  3.57757  3.57757  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2546 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.967  3.57757  3.57757  0.55
protocols.relax.FastRelax: {0} CMD: min  -203.164  3.66811  3.66811  0.55
protocols.relax.FastRelax: {0} MRP: 2  -203.164  -203.413  3.68211  3.68211
protocols.relax.FastRelax: {0} CMD: accept_to_best  -203.164  3.66811  3.66811  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -203.164  3.66811  3.66811  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -203.164  3.66811  3.66811  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.978  3.66811  3.66811  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2905 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -275.442  3.66811  3.66811  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.381  3.66811  3.66811  0.02805
protocols.relax.FastRelax: {0} CMD: min  -310.194  4.35731  4.35731  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -310.194  4.35731  4.35731  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.171  4.35731  4.35731  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2905 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.856  4.35731  4.35731  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.85  4.35731  4.35731  0.154
protocols.relax.FastRelax: {0} CMD: min  -257.559  3.94432  3.94432  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.559  3.94432  3.94432  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.913  3.94432  3.94432  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2847 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.088  3.94432  3.94432  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.197  3.94432  3.94432  0.31955
protocols.relax.FastRelax: {0} CMD: min  -224.427  3.86942  3.86942  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.427  3.86942  3.86942  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.505  3.86942  3.86942  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2537 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.089  3.86942  3.86942  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.3  3.78611  3.78611  0.55
protocols.relax.FastRelax: {0} MRP: 3  -204.3  -204.3  3.78611  3.78611
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.3  3.78611  3.78611  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.3  3.78611  3.78611  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.3  3.78611  3.78611  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.432  3.78611  3.78611  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3119 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -275.033  3.78611  3.78611  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -272.094  3.78611  3.78611  0.02805
protocols.relax.FastRelax: {0} CMD: min  -305.384  4.53894  4.53894  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -305.384  4.53894  4.53894  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.404  4.53894  4.53894  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2974 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.342  4.53894  4.53894  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.862  4.53894  4.53894  0.154
protocols.relax.FastRelax: {0} CMD: min  -255.673  4.03327  4.03327  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.673  4.03327  4.03327  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.618  4.03327  4.03327  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2937 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.512  4.03327  4.03327  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.642  4.03327  4.03327  0.31955
protocols.relax.FastRelax: {0} CMD: min  -225.636  3.92933  3.92933  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.636  3.92933  3.92933  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.688  3.92933  3.92933  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2800 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -185.743  3.92933  3.92933  0.55
protocols.relax.FastRelax: {0} CMD: min  -207.979  3.85003  3.85003  0.55
protocols.relax.FastRelax: {0} MRP: 4  -207.979  -207.979  3.85003  3.85003
protocols.relax.FastRelax: {0} CMD: accept_to_best  -207.979  3.85003  3.85003  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -207.979  3.85003  3.85003  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_42.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71290.1  14.3363  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71290.1  14.3363  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7259.1  14.3363  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2800 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -123.16  14.3363  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -111.158  14.3363  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -253.721  13.9914  2.79896  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.721  13.9914  2.79896  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -126.65  13.9914  2.79896  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2552 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -124.213  13.9914  2.79896  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -117.929  13.9914  2.79896  0.154
protocols.relax.FastRelax: {0} CMD: min  -218.736  13.1095  6.64941  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218.736  13.1095  6.64941  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.093  13.1095  6.64941  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2558 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.067  13.1095  6.64941  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.349  13.1095  6.64941  0.31955
protocols.relax.FastRelax: {0} CMD: min  -191.035  13.3038  6.54052  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -191.035  13.3038  6.54052  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -152.815  13.3038  6.54052  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2552 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -153.256  13.3038  6.54052  0.55
protocols.relax.FastRelax: {0} CMD: min  -186.108  13.6172  6.47178  0.55
protocols.relax.FastRelax: {0} MRP: 0  -186.108  -186.108  13.6172  6.47178
protocols.relax.FastRelax: {0} CMD: accept_to_best  -186.108  13.6172  6.47178  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -186.108  13.6172  6.47178  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -186.108  13.6172  6.47178  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.479  13.6172  6.47178  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2579 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -257.234  13.6172  6.47178  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.264  13.6172  6.47178  0.02805
protocols.relax.FastRelax: {0} CMD: min  -296.716  13.1468  6.60156  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -296.716  13.1468  6.60156  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.397  13.1468  6.60156  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2886 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -204.499  13.1468  6.60156  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.879  13.1468  6.60156  0.154
protocols.relax.FastRelax: {0} CMD: min  -243.821  13.1731  7.24537  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.821  13.1731  7.24537  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.531  13.1731  7.24537  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2739 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.743  13.1731  7.24537  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.786  13.1731  7.24537  0.31955
protocols.relax.FastRelax: {0} CMD: min  -214.692  13.3632  6.92636  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -214.692  13.3632  6.92636  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.63  13.3632  6.92636  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2534 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.91  13.3632  6.92636  0.55
protocols.relax.FastRelax: {0} CMD: min  -196.846  13.3649  7.28117  0.55
protocols.relax.FastRelax: {0} MRP: 1  -196.846  -196.846  13.3649  7.28117
protocols.relax.FastRelax: {0} CMD: accept_to_best  -196.846  13.3649  7.28117  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -196.846  13.3649  7.28117  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.846  13.3649  7.28117  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.792  13.3649  7.28117  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2876 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -265.664  13.3649  7.28117  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.237  13.3649  7.28117  0.02805
protocols.relax.FastRelax: {0} CMD: min  -287.681  13.2208  7.52396  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -287.681  13.2208  7.52396  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.172  13.2208  7.52396  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2924 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.734  13.2208  7.52396  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.741  13.2208  7.52396  0.154
protocols.relax.FastRelax: {0} CMD: min  -249.759  13.254  7.68927  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.759  13.254  7.68927  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.602  13.254  7.68927  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2840 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.973  13.254  7.68927  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.372  13.254  7.68927  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.002  13.3392  7.40278  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.002  13.3392  7.40278  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.688  13.3392  7.40278  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2706 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.075  13.3392  7.40278  0.55
protocols.relax.FastRelax: {0} CMD: min  -200.975  13.2467  7.64149  0.55
protocols.relax.FastRelax: {0} MRP: 2  -200.975  -200.975  13.2467  7.64149
protocols.relax.FastRelax: {0} CMD: accept_to_best  -200.975  13.2467  7.64149  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -200.975  13.2467  7.64149  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.975  13.2467  7.64149  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.012  13.2467  7.64149  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2963 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -266.791  13.2467  7.64149  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.471  13.2467  7.64149  0.02805
protocols.relax.FastRelax: {0} CMD: min  -301.555  13.1218  7.69375  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -301.555  13.1218  7.69375  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.13  13.1218  7.69375  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3053 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.378  13.1218  7.69375  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.419  13.1218  7.69375  0.154
protocols.relax.FastRelax: {0} CMD: min  -254.494  13.2617  7.59412  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.494  13.2617  7.59412  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.467  13.2617  7.59412  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2727 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.044  13.2617  7.59412  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.383  13.2617  7.59412  0.31955
protocols.relax.FastRelax: {0} CMD: min  -224.919  13.4112  7.35149  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.919  13.4112  7.35149  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.048  13.4112  7.35149  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2571 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -189.067  13.4112  7.35149  0.55
protocols.relax.FastRelax: {0} CMD: min  -203.182  13.252  7.95491  0.55
protocols.relax.FastRelax: {0} MRP: 3  -203.182  -203.182  13.252  7.95491
protocols.relax.FastRelax: {0} CMD: accept_to_best  -203.182  13.252  7.95491  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -203.182  13.252  7.95491  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -203.182  13.252  7.95491  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.943  13.252  7.95491  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2716 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.985  13.252  7.95491  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.144  13.252  7.95491  0.02805
protocols.relax.FastRelax: {0} CMD: min  -302.515  13.062  8.32314  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -302.515  13.062  8.32314  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.196  13.062  8.32314  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3067 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.939  13.062  8.32314  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.636  13.062  8.32314  0.154
protocols.relax.FastRelax: {0} CMD: min  -257.451  13.1571  8.50383  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.451  13.1571  8.50383  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.81  13.1571  8.50383  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2827 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.351  13.1571  8.50383  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.695  13.1571  8.50383  0.31955
protocols.relax.FastRelax: {0} CMD: min  -226.535  13.196  8.41364  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.535  13.196  8.41364  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.407  13.196  8.41364  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2517 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -188.101  13.196  8.41364  0.55
protocols.relax.FastRelax: {0} CMD: min  -207.68  13.2675  8.27392  0.55
protocols.relax.FastRelax: {0} MRP: 4  -207.68  -207.68  13.2675  8.27392
protocols.relax.FastRelax: {0} CMD: accept_to_best  -207.68  13.2675  8.27392  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -207.68  13.2675  8.27392  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_38.pdb
protocols.relax.FastRelax: {0} CMD: repeat  64958.3  13.3789  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  64958.3  13.3789  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7043.81  13.3789  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2753 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  69.5456  13.3789  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  86.0489  13.3789  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -84.1739  13.6329  5.01846  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -84.1739  13.6329  5.01846  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  898.942  13.6329  5.01846  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3160 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -125.656  13.6329  5.01846  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -116.409  13.6329  5.01846  0.154
protocols.relax.FastRelax: {0} CMD: min  -236.75  13.8463  4.61552  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.75  13.8463  4.61552  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.507  13.8463  4.61552  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2723 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.92  13.8463  4.61552  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.213  13.8463  4.61552  0.31955
protocols.relax.FastRelax: {0} CMD: min  -210.021  13.8719  4.49298  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.021  13.8719  4.49298  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -165.483  13.8719  4.49298  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2433 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -165.973  13.8719  4.49298  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.281  14.3135  6.5008  0.55
protocols.relax.FastRelax: {0} MRP: 0  -217.281  -217.281  14.3135  6.5008
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.281  14.3135  6.5008  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.281  14.3135  6.5008  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.281  14.3135  6.5008  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.316  14.3135  6.5008  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2779 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -302.221  14.3135  6.5008  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.052  14.3135  6.5008  0.02805
protocols.relax.FastRelax: {0} CMD: min  -339.396  14.1289  7.18848  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -339.396  14.1289  7.18848  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.877  14.1289  7.18848  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2818 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.63  14.1289  7.18848  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.719  14.1289  7.18848  0.154
protocols.relax.FastRelax: {0} CMD: min  -282.474  14.1473  6.81627  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.474  14.1473  6.81627  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.762  14.1473  6.81627  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2748 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.447  14.1473  6.81627  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.256  14.1473  6.81627  0.31955
protocols.relax.FastRelax: {0} CMD: min  -250.708  14.1837  6.81055  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.708  14.1837  6.81055  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.839  14.1837  6.81055  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2693 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.956  14.1837  6.81055  0.55
protocols.relax.FastRelax: {0} CMD: min  -236.438  14.0099  7.67519  0.55
protocols.relax.FastRelax: {0} MRP: 1  -236.438  -236.438  14.0099  7.67519
protocols.relax.FastRelax: {0} CMD: accept_to_best  -236.438  14.0099  7.67519  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -236.438  14.0099  7.67519  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.438  14.0099  7.67519  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -300.733  14.0099  7.67519  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3216 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -320.66  14.0099  7.67519  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -317.283  14.0099  7.67519  0.02805
protocols.relax.FastRelax: {0} CMD: min  -369.387  13.7502  7.82319  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -369.387  13.7502  7.82319  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.794  13.7502  7.82319  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3340 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -245.84  13.7502  7.82319  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.954  13.7502  7.82319  0.154
protocols.relax.FastRelax: {0} CMD: min  -296.156  13.9475  8.22156  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -296.156  13.9475  8.22156  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.187  13.9475  8.22156  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3155 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.393  13.9475  8.22156  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.036  13.9475  8.22156  0.31955
protocols.relax.FastRelax: {0} CMD: min  -260.868  13.9744  8.09994  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.868  13.9744  8.09994  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.728  13.9744  8.09994  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3030 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.638  13.9744  8.09994  0.55
protocols.relax.FastRelax: {0} CMD: min  -245.926  14.126  8.57899  0.55
protocols.relax.FastRelax: {0} MRP: 2  -245.926  -245.926  14.126  8.57899
protocols.relax.FastRelax: {0} CMD: accept_to_best  -245.926  14.126  8.57899  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -245.926  14.126  8.57899  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.926  14.126  8.57899  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -309.837  14.126  8.57899  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3152 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -330.324  14.126  8.57899  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -327.513  14.126  8.57899  0.02805
protocols.relax.FastRelax: {0} CMD: min  -375.703  13.8934  8.79905  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -375.703  13.8934  8.79905  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.651  13.8934  8.79905  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3287 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -255.132  13.8934  8.79905  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.894  13.8934  8.79905  0.154
protocols.relax.FastRelax: {0} CMD: min  -309.339  14.0471  8.24379  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -309.339  14.0471  8.24379  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.297  14.0471  8.24379  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3027 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -262.609  14.0471  8.24379  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.929  14.0471  8.24379  0.31955
protocols.relax.FastRelax: {0} CMD: min  -275.207  14.15  8.15651  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.207  14.15  8.15651  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.451  14.15  8.15651  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2858 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.676  14.15  8.15651  0.55
protocols.relax.FastRelax: {0} CMD: min  -254.459  14.0787  7.95449  0.55
protocols.relax.FastRelax: {0} MRP: 3  -254.459  -254.459  14.0787  7.95449
protocols.relax.FastRelax: {0} CMD: accept_to_best  -254.459  14.0787  7.95449  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -254.459  14.0787  7.95449  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.459  14.0787  7.95449  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -320.139  14.0787  7.95449  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3287 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -334.189  14.0787  7.95449  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -330.899  14.0787  7.95449  0.02805
protocols.relax.FastRelax: {0} CMD: min  -374.981  13.9893  8.21183  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -374.981  13.9893  8.21183  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.252  13.9893  8.21183  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3363 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -277.432  13.9893  8.21183  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.53  13.9893  8.21183  0.154
protocols.relax.FastRelax: {0} CMD: min  -317.182  13.9717  7.88002  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.182  13.9717  7.88002  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.932  13.9717  7.88002  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3109 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -274.709  13.9717  7.88002  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.358  13.9717  7.88002  0.31955
protocols.relax.FastRelax: {0} CMD: min  -281.681  13.9569  7.83652  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -281.681  13.9569  7.83652  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.027  13.9569  7.83652  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3026 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.629  13.9569  7.83652  0.55
protocols.relax.FastRelax: {0} CMD: min  -259.659  13.9299  7.84778  0.55
protocols.relax.FastRelax: {0} MRP: 4  -259.659  -259.659  13.9299  7.84778
protocols.relax.FastRelax: {0} CMD: accept_to_best  -259.659  13.9299  7.84778  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -259.659  13.9299  7.84778  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_17.pdb
protocols.relax.FastRelax: {0} CMD: repeat  72027.1  14.4626  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  72027.1  14.4626  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7050.17  14.4626  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2196 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -9.5297  14.4626  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  33.0597  14.4626  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -170.728  17.7776  15.8161  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -170.728  17.7776  15.8161  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -57.5239  17.7776  15.8161  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1996 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -115.32  17.7776  15.8161  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -111.609  17.7776  15.8161  0.154
protocols.relax.FastRelax: {0} CMD: min  -157.222  15.9444  8.65834  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -157.222  15.9444  8.65834  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -120.55  15.9444  8.65834  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1875 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -129.445  15.9444  8.65834  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -126.997  15.9444  8.65834  0.31955
protocols.relax.FastRelax: {0} CMD: min  -135.375  15.988  8.46043  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -135.375  15.988  8.46043  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -102.266  15.988  8.46043  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1852 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -102.567  15.988  8.46043  0.55
protocols.relax.FastRelax: {0} CMD: min  -138.451  17.3483  12.4072  0.55
protocols.relax.FastRelax: {0} MRP: 0  -138.451  -138.451  17.3483  12.4072
protocols.relax.FastRelax: {0} CMD: accept_to_best  -138.451  17.3483  12.4072  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -138.451  17.3483  12.4072  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -138.451  17.3483  12.4072  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.866  17.3483  12.4072  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1914 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.236  17.3483  12.4072  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.756  17.3483  12.4072  0.02805
protocols.relax.FastRelax: {0} CMD: min  -199.041  17.3498  12.4282  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -199.041  17.3498  12.4282  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -151.359  17.3498  12.4282  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1871 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.245  17.3498  12.4282  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.124  17.3498  12.4282  0.154
protocols.relax.FastRelax: {0} CMD: min  -179.211  17.3504  12.4324  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -179.211  17.3504  12.4324  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.352  17.3504  12.4324  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1859 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -158.505  17.3504  12.4324  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -156.92  17.3504  12.4324  0.31955
protocols.relax.FastRelax: {0} CMD: min  -161.644  16.9723  11.6026  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -161.644  16.9723  11.6026  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -130.796  16.9723  11.6026  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1833 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -130.701  16.9723  11.6026  0.55
protocols.relax.FastRelax: {0} CMD: min  -141.799  17.0587  12.5809  0.55
protocols.relax.FastRelax: {0} MRP: 1  -141.799  -141.799  17.0587  12.5809
protocols.relax.FastRelax: {0} CMD: accept_to_best  -141.799  17.0587  12.5809  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -141.799  17.0587  12.5809  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -141.799  17.0587  12.5809  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.883  17.0587  12.5809  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1911 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -204.971  17.0587  12.5809  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.91  17.0587  12.5809  0.02805
protocols.relax.FastRelax: {0} CMD: min  -204.293  17.07  12.6754  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.293  17.07  12.6754  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -143.948  17.07  12.6754  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1864 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.508  17.07  12.6754  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.197  17.07  12.6754  0.154
protocols.relax.FastRelax: {0} CMD: min  -180.888  17.0405  12.5956  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -180.888  17.0405  12.5956  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.379  17.0405  12.5956  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1844 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -159.777  17.0405  12.5956  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.163  17.0405  12.5956  0.31955
protocols.relax.FastRelax: {0} CMD: min  -158.532  17.0356  12.5818  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -158.532  17.0356  12.5818  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -128.173  17.0356  12.5818  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1827 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -128.525  17.0356  12.5818  0.55
protocols.relax.FastRelax: {0} CMD: min  -150.239  16.968  12.2156  0.55
protocols.relax.FastRelax: {0} MRP: 2  -150.239  -150.239  16.968  12.2156
protocols.relax.FastRelax: {0} CMD: accept_to_best  -150.239  16.968  12.2156  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -150.239  16.968  12.2156  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -150.239  16.968  12.2156  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.013  16.968  12.2156  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1909 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.022  16.968  12.2156  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.024  16.968  12.2156  0.02805
protocols.relax.FastRelax: {0} CMD: min  -242.69  16.8002  12.182  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.69  16.8002  12.182  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.729  16.8002  12.182  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2121 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.96  16.8002  12.182  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.166  16.8002  12.182  0.154
protocols.relax.FastRelax: {0} CMD: min  -205.928  17.1117  13.0547  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.928  17.1117  13.0547  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.959  17.1117  13.0547  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1996 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.178  17.1117  13.0547  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.773  17.1117  13.0547  0.31955
protocols.relax.FastRelax: {0} CMD: min  -173.131  17.1192  13.0709  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -173.131  17.1192  13.0709  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -128.579  17.1192  13.0709  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1839 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -129.154  17.1192  13.0709  0.55
protocols.relax.FastRelax: {0} CMD: min  -49.3147  17.8109  16.5842  0.55
protocols.relax.FastRelax: {0} MRP: 3  -49.3147  -150.239  16.968  12.2156
protocols.relax.FastRelax: {0} CMD: accept_to_best  -49.3147  17.8109  16.5842  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -49.3147  17.8109  16.5842  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -49.3147  17.8109  16.5842  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.266  17.8109  16.5842  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1892 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.535  17.8109  16.5842  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.439  17.8109  16.5842  0.02805
protocols.relax.FastRelax: {0} CMD: min  -262.775  17.9952  17.5648  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.775  17.9952  17.5648  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.079  17.9952  17.5648  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2085 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -193.064  17.9952  17.5648  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.854  17.9952  17.5648  0.154
protocols.relax.FastRelax: {0} CMD: min  -220.139  17.8069  17.2032  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.139  17.8069  17.2032  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.62  17.8069  17.2032  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1984 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -188.15  17.8069  17.2032  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.621  17.8069  17.2032  0.31955
protocols.relax.FastRelax: {0} CMD: min  -193.125  17.8389  17.073  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.125  17.8389  17.073  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.378  17.8389  17.073  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1951 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -158.431  17.8389  17.073  0.55
protocols.relax.FastRelax: {0} CMD: min  -170.189  17.7889  16.8271  0.55
protocols.relax.FastRelax: {0} MRP: 4  -170.189  -170.189  17.7889  16.8271
protocols.relax.FastRelax: {0} CMD: accept_to_best  -170.189  17.7889  16.8271  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -170.189  17.7889  16.8271  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_10.pdb
protocols.relax.FastRelax: {0} CMD: repeat  72460.9  13.2865  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  72460.9  13.2865  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7534.75  13.2865  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2913 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  213.985  13.2865  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  263.015  13.2865  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -253.139  12.2296  3.84314  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.139  12.2296  3.84314  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -84.6722  12.2296  3.84314  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2677 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -118.918  12.2296  3.84314  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -110.49  12.2296  3.84314  0.154
protocols.relax.FastRelax: {0} CMD: min  -210.591  11.8419  3.74611  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.591  11.8419  3.74611  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.252  11.8419  3.74611  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2372 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -164.965  11.8419  3.74611  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -161.301  11.8419  3.74611  0.31955
protocols.relax.FastRelax: {0} CMD: min  -169.502  11.9707  3.6967  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -169.502  11.9707  3.6967  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -120.145  11.9707  3.6967  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2284 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -120.506  11.9707  3.6967  0.55
protocols.relax.FastRelax: {0} CMD: min  -164.521  12.4847  5.06513  0.55
protocols.relax.FastRelax: {0} MRP: 0  -164.521  -164.521  12.4847  5.06513
protocols.relax.FastRelax: {0} CMD: accept_to_best  -164.521  12.4847  5.06513  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -164.521  12.4847  5.06513  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -164.521  12.4847  5.06513  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.116  12.4847  5.06513  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2544 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -247.354  12.4847  5.06513  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.244  12.4847  5.06513  0.02805
protocols.relax.FastRelax: {0} CMD: min  -289.065  12.1306  5.31916  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -289.065  12.1306  5.31916  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -165.514  12.1306  5.31916  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2464 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.88  12.1306  5.31916  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.272  12.1306  5.31916  0.154
protocols.relax.FastRelax: {0} CMD: min  -246.676  12.2424  5.82214  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.676  12.2424  5.82214  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.473  12.2424  5.82214  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2391 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.138  12.2424  5.82214  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.292  12.2424  5.82214  0.31955
protocols.relax.FastRelax: {0} CMD: min  -208.686  12.3724  5.99378  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.686  12.3724  5.99378  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.951  12.3724  5.99378  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2314 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -160.258  12.3724  5.99378  0.55
protocols.relax.FastRelax: {0} CMD: min  -184.313  12.8891  6.27468  0.55
protocols.relax.FastRelax: {0} MRP: 1  -184.313  -184.313  12.8891  6.27468
protocols.relax.FastRelax: {0} CMD: accept_to_best  -184.313  12.8891  6.27468  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -184.313  12.8891  6.27468  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -184.313  12.8891  6.27468  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.812  12.8891  6.27468  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2584 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -265.337  12.8891  6.27468  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.854  12.8891  6.27468  0.02805
protocols.relax.FastRelax: {0} CMD: min  -322.13  13.102  6.52949  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -322.13  13.102  6.52949  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.001  13.102  6.52949  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2642 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -171.454  13.102  6.52949  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -161.734  13.102  6.52949  0.154
protocols.relax.FastRelax: {0} CMD: min  -248.106  13.31  6.30405  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.106  13.31  6.30405  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.478  13.31  6.30405  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2512 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.471  13.31  6.30405  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.233  13.31  6.30405  0.31955
protocols.relax.FastRelax: {0} CMD: min  -204.617  13.4061  6.30048  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.617  13.4061  6.30048  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -150.241  13.4061  6.30048  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2424 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -149.924  13.4061  6.30048  0.55
protocols.relax.FastRelax: {0} CMD: min  -187.681  13.3387  5.77706  0.55
protocols.relax.FastRelax: {0} MRP: 2  -187.681  -187.681  13.3387  5.77706
protocols.relax.FastRelax: {0} CMD: accept_to_best  -187.681  13.3387  5.77706  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -187.681  13.3387  5.77706  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -187.681  13.3387  5.77706  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.983  13.3387  5.77706  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2671 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -275.995  13.3387  5.77706  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.319  13.3387  5.77706  0.02805
protocols.relax.FastRelax: {0} CMD: min  -344.474  13.2668  6.09689  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -344.474  13.2668  6.09689  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.622  13.2668  6.09689  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2745 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.588  13.2668  6.09689  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.567  13.2668  6.09689  0.154
protocols.relax.FastRelax: {0} CMD: min  -268.291  13.3054  5.96582  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.291  13.3054  5.96582  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.24  13.3054  5.96582  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2436 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.43  13.3054  5.96582  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.286  13.3054  5.96582  0.31955
protocols.relax.FastRelax: {0} CMD: min  -225.39  13.3908  6.02153  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.39  13.3908  6.02153  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.858  13.3908  6.02153  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2366 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -176.102  13.3908  6.02153  0.55
protocols.relax.FastRelax: {0} CMD: min  -195.165  13.5011  6.25551  0.55
protocols.relax.FastRelax: {0} MRP: 3  -195.165  -195.165  13.5011  6.25551
protocols.relax.FastRelax: {0} CMD: accept_to_best  -195.165  13.5011  6.25551  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -195.165  13.5011  6.25551  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -195.165  13.5011  6.25551  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.919  13.5011  6.25551  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2733 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -281.285  13.5011  6.25551  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.399  13.5011  6.25551  0.02805
protocols.relax.FastRelax: {0} CMD: min  -339.524  13.3153  6.48725  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -339.524  13.3153  6.48725  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.105  13.3153  6.48725  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2675 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.547  13.3153  6.48725  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.362  13.3153  6.48725  0.154
protocols.relax.FastRelax: {0} CMD: min  -260.128  13.3484  6.30028  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.128  13.3484  6.30028  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.96  13.3484  6.30028  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2503 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.64  13.3484  6.30028  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.714  13.3484  6.30028  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.407  13.4417  6.4236  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.407  13.4417  6.4236  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.502  13.4417  6.4236  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2383 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -172.776  13.4417  6.4236  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.987  13.5554  6.38684  0.55
protocols.relax.FastRelax: {0} MRP: 4  -194.987  -195.165  13.5011  6.25551
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.987  13.5554  6.38684  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.987  13.5554  6.38684  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_15.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70195.4  16.8396  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70195.4  16.8396  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7403.72  16.8396  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3128 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  112.751  16.8396  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  137.153  16.8396  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -123.596  16.5188  3.29307  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -123.596  16.5188  3.29307  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  694.927  16.5188  3.29307  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2950 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -157.818  16.5188  3.29307  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -150.413  16.5188  3.29307  0.154
protocols.relax.FastRelax: {0} CMD: min  -239.355  16.6271  3.23665  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.355  16.6271  3.23665  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.348  16.6271  3.23665  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2742 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.149  16.6271  3.23665  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.648  16.6271  3.23665  0.31955
protocols.relax.FastRelax: {0} CMD: min  -202.58  16.6584  3.21024  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.58  16.6584  3.21024  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.612  16.6584  3.21024  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2406 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -162.799  16.6584  3.21024  0.55
protocols.relax.FastRelax: {0} CMD: min  -209.707  16.6297  3.31095  0.55
protocols.relax.FastRelax: {0} MRP: 0  -209.707  -209.707  16.6297  3.31095
protocols.relax.FastRelax: {0} CMD: accept_to_best  -209.707  16.6297  3.31095  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -209.707  16.6297  3.31095  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.707  16.6297  3.31095  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.675  16.6297  3.31095  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2821 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -278.693  16.6297  3.31095  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.925  16.6297  3.31095  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.773  16.4826  3.45742  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.773  16.4826  3.45742  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.115  16.4826  3.45742  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2892 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.602  16.4826  3.45742  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.017  16.4826  3.45742  0.154
protocols.relax.FastRelax: {0} CMD: min  -274.974  16.4715  3.4282  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.974  16.4715  3.4282  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.537  16.4715  3.4282  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2724 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.229  16.4715  3.4282  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.247  16.4715  3.4282  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.905  16.502  3.34308  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.905  16.502  3.34308  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.843  16.502  3.34308  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2562 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.339  16.502  3.34308  0.55
protocols.relax.FastRelax: {0} CMD: min  -224.863  16.5077  3.60832  0.55
protocols.relax.FastRelax: {0} MRP: 1  -224.863  -224.863  16.5077  3.60832
protocols.relax.FastRelax: {0} CMD: accept_to_best  -224.863  16.5077  3.60832  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -224.863  16.5077  3.60832  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.863  16.5077  3.60832  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.187  16.5077  3.60832  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2826 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -293.716  16.5077  3.60832  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -291.546  16.5077  3.60832  0.02805
protocols.relax.FastRelax: {0} CMD: min  -335.583  16.4255  3.87878  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -335.583  16.4255  3.87878  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.967  16.4255  3.87878  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3092 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.469  16.4255  3.87878  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.533  16.4255  3.87878  0.154
protocols.relax.FastRelax: {0} CMD: min  -281.109  16.4684  3.64607  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -281.109  16.4684  3.64607  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.583  16.4684  3.64607  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2667 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.127  16.4684  3.64607  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.108  16.4684  3.64607  0.31955
protocols.relax.FastRelax: {0} CMD: min  -251.821  16.486  3.63936  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.821  16.486  3.63936  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.8  16.486  3.63936  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2398 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.875  16.486  3.63936  0.55
protocols.relax.FastRelax: {0} CMD: min  -228.689  16.4512  3.67512  0.55
protocols.relax.FastRelax: {0} MRP: 2  -228.689  -228.689  16.4512  3.67512
protocols.relax.FastRelax: {0} CMD: accept_to_best  -228.689  16.4512  3.67512  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -228.689  16.4512  3.67512  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.689  16.4512  3.67512  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.135  16.4512  3.67512  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2904 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -298.185  16.4512  3.67512  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -296.325  16.4512  3.67512  0.02805
protocols.relax.FastRelax: {0} CMD: min  -345.513  16.383  3.96537  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -345.513  16.383  3.96537  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.351  16.383  3.96537  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3094 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.172  16.383  3.96537  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.356  16.383  3.96537  0.154
protocols.relax.FastRelax: {0} CMD: min  -291.591  16.3959  3.78604  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -291.591  16.3959  3.78604  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.162  16.3959  3.78604  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2767 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -252.533  16.3959  3.78604  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.426  16.3959  3.78604  0.31955
protocols.relax.FastRelax: {0} CMD: min  -259.793  16.444  3.71571  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.793  16.444  3.71571  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.439  16.444  3.71571  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2628 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.582  16.444  3.71571  0.55
protocols.relax.FastRelax: {0} CMD: min  -237.561  16.6699  3.93544  0.55
protocols.relax.FastRelax: {0} MRP: 3  -237.561  -237.561  16.6699  3.93544
protocols.relax.FastRelax: {0} CMD: accept_to_best  -237.561  16.6699  3.93544  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -237.561  16.6699  3.93544  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.561  16.6699  3.93544  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -295.226  16.6699  3.93544  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2931 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -301.746  16.6699  3.93544  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -300.188  16.6699  3.93544  0.02805
protocols.relax.FastRelax: {0} CMD: min  -349.271  16.5668  4.25289  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -349.271  16.5668  4.25289  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.81  16.5668  4.25289  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2950 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.554  16.5668  4.25289  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.765  16.5668  4.25289  0.154
protocols.relax.FastRelax: {0} CMD: min  -290.889  16.665  4.09297  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -290.889  16.665  4.09297  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.041  16.665  4.09297  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2726 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.515  16.665  4.09297  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.395  16.665  4.09297  0.31955
protocols.relax.FastRelax: {0} CMD: min  -260.922  16.6861  4.09755  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.922  16.6861  4.09755  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.723  16.6861  4.09755  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2685 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.271  16.6861  4.09755  0.55
protocols.relax.FastRelax: {0} CMD: min  -239.452  16.7504  4.26543  0.55
protocols.relax.FastRelax: {0} MRP: 4  -239.452  -239.452  16.7504  4.26543
protocols.relax.FastRelax: {0} CMD: accept_to_best  -239.452  16.7504  4.26543  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -239.452  16.7504  4.26543  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_1.pdb
protocols.relax.FastRelax: {0} CMD: repeat  69250.2  18.6584  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  69250.2  18.6584  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6998.64  18.6584  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2723 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -99.8428  18.6584  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -79.0589  18.6584  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -284.922  18.9751  3.04848  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.922  18.9751  3.04848  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -127.749  18.9751  3.04848  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2826 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -147.282  18.9751  3.04848  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -138.214  18.9751  3.04848  0.154
protocols.relax.FastRelax: {0} CMD: min  -225.101  18.6158  3.00242  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.101  18.6158  3.00242  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.738  18.6158  3.00242  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2752 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.821  18.6158  3.00242  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.203  18.6158  3.00242  0.31955
protocols.relax.FastRelax: {0} CMD: min  -193.007  18.6975  3.13526  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.007  18.6975  3.13526  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -145.53  18.6975  3.13526  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2646 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -145.609  18.6975  3.13526  0.55
protocols.relax.FastRelax: {0} CMD: min  -200.196  18.065  3.64828  0.55
protocols.relax.FastRelax: {0} MRP: 0  -200.196  -200.196  18.065  3.64828
protocols.relax.FastRelax: {0} CMD: accept_to_best  -200.196  18.065  3.64828  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -200.196  18.065  3.64828  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.196  18.065  3.64828  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.061  18.065  3.64828  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2977 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.518  18.065  3.64828  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.973  18.065  3.64828  0.02805
protocols.relax.FastRelax: {0} CMD: min  -346.85  17.3367  3.58614  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -346.85  17.3367  3.58614  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.135  17.3367  3.58614  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3202 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.223  17.3367  3.58614  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.849  17.3367  3.58614  0.154
protocols.relax.FastRelax: {0} CMD: min  -289.206  17.1143  3.95136  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -289.206  17.1143  3.95136  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.886  17.1143  3.95136  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3034 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -244.005  17.1143  3.95136  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.368  17.1143  3.95136  0.31955
protocols.relax.FastRelax: {0} CMD: min  -248.106  17.1362  3.94081  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.106  17.1362  3.94081  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.061  17.1362  3.94081  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2871 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.936  17.1362  3.94081  0.55
protocols.relax.FastRelax: {0} CMD: min  -229.863  17.1998  4.01262  0.55
protocols.relax.FastRelax: {0} MRP: 1  -229.863  -229.863  17.1998  4.01262
protocols.relax.FastRelax: {0} CMD: accept_to_best  -229.863  17.1998  4.01262  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -229.863  17.1998  4.01262  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.863  17.1998  4.01262  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.86  17.1998  4.01262  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3079 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -310.094  17.1998  4.01262  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -307.83  17.1998  4.01262  0.02805
protocols.relax.FastRelax: {0} CMD: min  -372.32  16.8611  4.34356  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -372.32  16.8611  4.34356  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.422  16.8611  4.34356  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3420 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.24  16.8611  4.34356  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.365  16.8611  4.34356  0.154
protocols.relax.FastRelax: {0} CMD: min  -289.116  17.0451  4.25991  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -289.116  17.0451  4.25991  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.838  17.0451  4.25991  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3051 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.925  17.0451  4.25991  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.761  17.0451  4.25991  0.31955
protocols.relax.FastRelax: {0} CMD: min  -257.251  17.0219  4.2512  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.251  17.0219  4.2512  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.298  17.0219  4.2512  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2780 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.558  17.0219  4.2512  0.55
protocols.relax.FastRelax: {0} CMD: min  -232.553  17.1603  4.19257  0.55
protocols.relax.FastRelax: {0} MRP: 2  -232.553  -232.553  17.1603  4.19257
protocols.relax.FastRelax: {0} CMD: accept_to_best  -232.553  17.1603  4.19257  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -232.553  17.1603  4.19257  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.553  17.1603  4.19257  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -302.419  17.1603  4.19257  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3301 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -312.602  17.1603  4.19257  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -310.519  17.1603  4.19257  0.02805
protocols.relax.FastRelax: {0} CMD: min  -375.529  16.8452  4.40564  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -375.529  16.8452  4.40564  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.673  16.8452  4.40564  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3543 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.901  16.8452  4.40564  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.616  16.8452  4.40564  0.154
protocols.relax.FastRelax: {0} CMD: min  -301.372  16.9983  4.37045  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -301.372  16.9983  4.37045  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.404  16.9983  4.37045  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3100 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -252.582  16.9983  4.37045  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.742  16.9983  4.37045  0.31955
protocols.relax.FastRelax: {0} CMD: min  -260.402  17.0326  4.34032  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.402  17.0326  4.34032  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.469  17.0326  4.34032  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2838 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.555  17.0326  4.34032  0.55
protocols.relax.FastRelax: {0} CMD: min  -234.017  17.185  4.18573  0.55
protocols.relax.FastRelax: {0} MRP: 3  -234.017  -234.017  17.185  4.18573
protocols.relax.FastRelax: {0} CMD: accept_to_best  -234.017  17.185  4.18573  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -234.017  17.185  4.18573  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -234.017  17.185  4.18573  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -304.664  17.185  4.18573  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3284 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -313.553  17.185  4.18573  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -310.76  17.185  4.18573  0.02805
protocols.relax.FastRelax: {0} CMD: min  -364.171  16.8602  4.43563  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -364.171  16.8602  4.43563  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.734  16.8602  4.43563  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3489 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -247.763  16.8602  4.43563  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.131  16.8602  4.43563  0.154
protocols.relax.FastRelax: {0} CMD: min  -301.42  17.0069  4.38897  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -301.42  17.0069  4.38897  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.474  17.0069  4.38897  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3170 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -252.865  17.0069  4.38897  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.044  17.0069  4.38897  0.31955
protocols.relax.FastRelax: {0} CMD: min  -262.226  17.0323  4.25864  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.226  17.0323  4.25864  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.569  17.0323  4.25864  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2944 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.706  17.0323  4.25864  0.55
protocols.relax.FastRelax: {0} CMD: min  -233.599  17.1842  4.18093  0.55
protocols.relax.FastRelax: {0} MRP: 4  -233.599  -234.017  17.185  4.18573
protocols.relax.FastRelax: {0} CMD: accept_to_best  -233.599  17.1842  4.18093  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -233.599  17.1842  4.18093  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_36.pdb
protocols.relax.FastRelax: {0} CMD: repeat  68706.6  14.1816  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  68706.6  14.1816  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7170.88  14.1816  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2436 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -110.799  14.1816  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -93.8917  14.1816  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -239.057  13.6125  3.77947  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.057  13.6125  3.77947  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -129.189  13.6125  3.77947  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2427 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -145.713  13.6125  3.77947  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -139.422  13.6125  3.77947  0.154
protocols.relax.FastRelax: {0} CMD: min  -209.876  13.5064  3.76835  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.876  13.5064  3.76835  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.323  13.5064  3.76835  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2367 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -173.862  13.5064  3.76835  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.949  13.5064  3.76835  0.31955
protocols.relax.FastRelax: {0} CMD: min  -179.527  13.5743  3.70637  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -179.527  13.5743  3.70637  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -138.767  13.5743  3.70637  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2360 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -139.073  13.5743  3.70637  0.55
protocols.relax.FastRelax: {0} CMD: min  -170.314  13.6006  4.4007  0.55
protocols.relax.FastRelax: {0} MRP: 0  -170.314  -170.314  13.6006  4.4007
protocols.relax.FastRelax: {0} CMD: accept_to_best  -170.314  13.6006  4.4007  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -170.314  13.6006  4.4007  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -170.314  13.6006  4.4007  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.125  13.6006  4.4007  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2449 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.468  13.6006  4.4007  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.511  13.6006  4.4007  0.02805
protocols.relax.FastRelax: {0} CMD: min  -296.359  13.3584  4.75102  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -296.359  13.3584  4.75102  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.741  13.3584  4.75102  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2775 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.501  13.3584  4.75102  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.255  13.3584  4.75102  0.154
protocols.relax.FastRelax: {0} CMD: min  -239.539  13.4596  4.65558  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.539  13.4596  4.65558  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.413  13.4596  4.65558  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2368 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.458  13.4596  4.65558  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.136  13.4596  4.65558  0.31955
protocols.relax.FastRelax: {0} CMD: min  -207.667  13.5589  4.69236  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -207.667  13.5589  4.69236  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -165.958  13.5589  4.69236  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2263 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -166.783  13.5589  4.69236  0.55
protocols.relax.FastRelax: {0} CMD: min  -192.126  13.6615  4.50462  0.55
protocols.relax.FastRelax: {0} MRP: 1  -192.126  -192.126  13.6615  4.50462
protocols.relax.FastRelax: {0} CMD: accept_to_best  -192.126  13.6615  4.50462  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -192.126  13.6615  4.50462  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -192.126  13.6615  4.50462  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.052  13.6615  4.50462  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2416 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.964  13.6615  4.50462  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.761  13.6615  4.50462  0.02805
protocols.relax.FastRelax: {0} CMD: min  -311.538  13.4192  5.07206  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.538  13.4192  5.07206  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.74  13.4192  5.07206  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2819 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.151  13.4192  5.07206  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.699  13.4192  5.07206  0.154
protocols.relax.FastRelax: {0} CMD: min  -256.061  13.4759  4.88151  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.061  13.4759  4.88151  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.86  13.4759  4.88151  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2404 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.11  13.4759  4.88151  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.776  13.4759  4.88151  0.31955
protocols.relax.FastRelax: {0} CMD: min  -218  13.5987  4.83495  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218  13.5987  4.83495  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.182  13.5987  4.83495  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2399 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -169.808  13.5987  4.83495  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.748  13.6475  4.8421  0.55
protocols.relax.FastRelax: {0} MRP: 2  -204.748  -204.748  13.6475  4.8421
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.748  13.6475  4.8421  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.748  13.6475  4.8421  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.748  13.6475  4.8421  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -272.558  13.6475  4.8421  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2563 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -276.609  13.6475  4.8421  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.097  13.6475  4.8421  0.02805
protocols.relax.FastRelax: {0} CMD: min  -303.702  13.4795  5.33968  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -303.702  13.4795  5.33968  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.066  13.4795  5.33968  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2715 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.866  13.4795  5.33968  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.838  13.4795  5.33968  0.154
protocols.relax.FastRelax: {0} CMD: min  -266.862  13.5258  5.17575  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -266.862  13.5258  5.17575  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.843  13.5258  5.17575  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2579 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.456  13.5258  5.17575  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.525  13.5258  5.17575  0.31955
protocols.relax.FastRelax: {0} CMD: min  -232.491  13.6171  5.06623  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.491  13.6171  5.06623  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.871  13.6171  5.06623  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2438 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -189.244  13.6171  5.06623  0.55
protocols.relax.FastRelax: {0} CMD: min  -206.932  13.6924  4.81416  0.55
protocols.relax.FastRelax: {0} MRP: 3  -206.932  -206.932  13.6924  4.81416
protocols.relax.FastRelax: {0} CMD: accept_to_best  -206.932  13.6924  4.81416  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -206.932  13.6924  4.81416  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -206.932  13.6924  4.81416  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.438  13.6924  4.81416  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2556 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -278.034  13.6924  4.81416  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.013  13.6924  4.81416  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.964  13.3433  5.36528  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.964  13.3433  5.36528  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.907  13.3433  5.36528  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2789 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.786  13.3433  5.36528  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.645  13.3433  5.36528  0.154
protocols.relax.FastRelax: {0} CMD: min  -255.384  13.4881  5.25825  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.384  13.4881  5.25825  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.582  13.4881  5.25825  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2447 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.752  13.4881  5.25825  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.224  13.4881  5.25825  0.31955
protocols.relax.FastRelax: {0} CMD: min  -226.666  13.4411  5.44252  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.666  13.4411  5.44252  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.945  13.4411  5.44252  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2436 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.205  13.4411  5.44252  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.311  13.3973  5.68271  0.55
protocols.relax.FastRelax: {0} MRP: 4  -212.311  -212.311  13.3973  5.68271
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.311  13.3973  5.68271  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.311  13.3973  5.68271  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_41.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71980.9  17.1605  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71980.9  17.1605  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6769.33  17.1605  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3348 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  145.953  17.1605  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  193.969  17.1605  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -307.455  16.1739  2.83179  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -307.455  16.1739  2.83179  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -78.6838  16.1739  2.83179  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3124 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -122.217  16.1739  2.83179  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -110.61  16.1739  2.83179  0.154
protocols.relax.FastRelax: {0} CMD: min  -226.706  16.1338  3.26471  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.706  16.1338  3.26471  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.737  16.1338  3.26471  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2654 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -177.833  16.1338  3.26471  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.746  16.1338  3.26471  0.31955
protocols.relax.FastRelax: {0} CMD: min  -197.451  16.0935  3.3981  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.451  16.0935  3.3981  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -150.092  16.0935  3.3981  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2653 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -151.514  16.0935  3.3981  0.55
protocols.relax.FastRelax: {0} CMD: min  -221.027  15.9275  4.22332  0.55
protocols.relax.FastRelax: {0} MRP: 0  -221.027  -221.027  15.9275  4.22332
protocols.relax.FastRelax: {0} CMD: accept_to_best  -221.027  15.9275  4.22332  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -221.027  15.9275  4.22332  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.027  15.9275  4.22332  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.26  15.9275  4.22332  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2688 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -305.409  15.9275  4.22332  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -302.575  15.9275  4.22332  0.02805
protocols.relax.FastRelax: {0} CMD: min  -356.031  15.9516  4.37532  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -356.031  15.9516  4.37532  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160.389  15.9516  4.37532  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3108 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.332  15.9516  4.37532  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.691  15.9516  4.37532  0.154
protocols.relax.FastRelax: {0} CMD: min  -282.14  15.878  4.47822  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.14  15.878  4.47822  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.859  15.878  4.47822  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2693 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.548  15.878  4.47822  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.926  15.878  4.47822  0.31955
protocols.relax.FastRelax: {0} CMD: min  -243.854  16.0612  4.38799  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.854  16.0612  4.38799  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.273  16.0612  4.38799  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2587 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.982  16.0612  4.38799  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.573  16.0066  4.08916  0.55
protocols.relax.FastRelax: {0} MRP: 1  -230.573  -230.573  16.0066  4.08916
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.573  16.0066  4.08916  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.573  16.0066  4.08916  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.573  16.0066  4.08916  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -292.616  16.0066  4.08916  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2763 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -313.993  16.0066  4.08916  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -311.71  16.0066  4.08916  0.02805
protocols.relax.FastRelax: {0} CMD: min  -377.989  15.8523  4.43816  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -377.989  15.8523  4.43816  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.669  15.8523  4.43816  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2873 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.558  15.8523  4.43816  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.051  15.8523  4.43816  0.154
protocols.relax.FastRelax: {0} CMD: min  -300.272  15.8469  4.34729  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -300.272  15.8469  4.34729  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.768  15.8469  4.34729  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2648 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -253.301  15.8469  4.34729  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.626  15.8469  4.34729  0.31955
protocols.relax.FastRelax: {0} CMD: min  -263.862  15.9347  4.29741  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -263.862  15.9347  4.29741  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.099  15.9347  4.29741  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2510 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.216  15.9347  4.29741  0.55
protocols.relax.FastRelax: {0} CMD: min  -242.899  15.8964  4.35651  0.55
protocols.relax.FastRelax: {0} MRP: 2  -242.899  -242.899  15.8964  4.35651
protocols.relax.FastRelax: {0} CMD: accept_to_best  -242.899  15.8964  4.35651  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -242.899  15.8964  4.35651  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.899  15.8964  4.35651  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -305.645  15.8964  4.35651  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2797 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -319.532  15.8964  4.35651  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -317.504  15.8964  4.35651  0.02805
protocols.relax.FastRelax: {0} CMD: min  -372.267  15.7307  4.32848  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -372.267  15.7307  4.32848  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.501  15.7307  4.32848  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2834 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.099  15.7307  4.32848  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.923  15.7307  4.32848  0.154
protocols.relax.FastRelax: {0} CMD: min  -298.154  15.8176  4.3195  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -298.154  15.8176  4.3195  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.803  15.8176  4.3195  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2715 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -255.644  15.8176  4.3195  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.1  15.8176  4.3195  0.31955
protocols.relax.FastRelax: {0} CMD: min  -266.515  15.8937  4.3476  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -266.515  15.8937  4.3476  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.166  15.8937  4.3476  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2531 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.031  15.8937  4.3476  0.55
protocols.relax.FastRelax: {0} CMD: min  -245.238  15.901  4.40622  0.55
protocols.relax.FastRelax: {0} MRP: 3  -245.238  -245.238  15.901  4.40622
protocols.relax.FastRelax: {0} CMD: accept_to_best  -245.238  15.901  4.40622  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -245.238  15.901  4.40622  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.238  15.901  4.40622  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -308  15.901  4.40622  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2927 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -321.744  15.901  4.40622  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -319.445  15.901  4.40622  0.02805
protocols.relax.FastRelax: {0} CMD: min  -371.709  15.8528  4.24391  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -371.709  15.8528  4.24391  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.528  15.8528  4.24391  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3045 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.956  15.8528  4.24391  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.779  15.8528  4.24391  0.154
protocols.relax.FastRelax: {0} CMD: min  -308.169  15.893  4.37069  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -308.169  15.893  4.37069  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.147  15.893  4.37069  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2847 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -261.951  15.893  4.37069  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.326  15.893  4.37069  0.31955
protocols.relax.FastRelax: {0} CMD: min  -272.502  15.984  4.41689  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -272.502  15.984  4.41689  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.748  15.984  4.41689  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2710 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.392  15.984  4.41689  0.55
protocols.relax.FastRelax: {0} CMD: min  -250.201  16.0511  4.44631  0.55
protocols.relax.FastRelax: {0} MRP: 4  -250.201  -250.201  16.0511  4.44631
protocols.relax.FastRelax: {0} CMD: accept_to_best  -250.201  16.0511  4.44631  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -250.201  16.0511  4.44631  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_9.pdb
protocols.relax.FastRelax: {0} CMD: repeat  69317.7  16.7553  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  69317.7  16.7553  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7060.35  16.7553  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2472 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  104.001  16.7553  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  117.503  16.7553  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -235.873  16.3277  4.84784  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.873  16.3277  4.84784  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -114.476  16.3277  4.84784  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2349 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -158.237  16.3277  4.84784  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -152.8  16.3277  4.84784  0.154
protocols.relax.FastRelax: {0} CMD: min  -195.157  16.526  4.63362  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -195.157  16.526  4.63362  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.966  16.526  4.63362  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2213 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -155.133  16.526  4.63362  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -151.928  16.526  4.63362  0.31955
protocols.relax.FastRelax: {0} CMD: min  -167.432  16.6203  5.09566  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -167.432  16.6203  5.09566  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -126.973  16.6203  5.09566  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2138 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -127.879  16.6203  5.09566  0.55
protocols.relax.FastRelax: {0} CMD: min  -193.664  15.9509  5.00789  0.55
protocols.relax.FastRelax: {0} MRP: 0  -193.664  -193.664  15.9509  5.00789
protocols.relax.FastRelax: {0} CMD: accept_to_best  -193.664  15.9509  5.00789  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -193.664  15.9509  5.00789  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.664  15.9509  5.00789  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.021  15.9509  5.00789  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2474 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.178  15.9509  5.00789  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.107  15.9509  5.00789  0.02805
protocols.relax.FastRelax: {0} CMD: min  -291.604  15.6378  5.03472  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -291.604  15.6378  5.03472  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.411  15.6378  5.03472  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2613 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.134  15.6378  5.03472  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.103  15.6378  5.03472  0.154
protocols.relax.FastRelax: {0} CMD: min  -250.089  15.9074  5.29988  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.089  15.9074  5.29988  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.874  15.9074  5.29988  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2373 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.136  15.9074  5.29988  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.454  15.9074  5.29988  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.458  16.0603  5.19974  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.458  16.0603  5.19974  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.032  16.0603  5.19974  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2300 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.075  16.0603  5.19974  0.55
protocols.relax.FastRelax: {0} CMD: min  -203.994  15.9166  5.98788  0.55
protocols.relax.FastRelax: {0} MRP: 1  -203.994  -203.994  15.9166  5.98788
protocols.relax.FastRelax: {0} CMD: accept_to_best  -203.994  15.9166  5.98788  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -203.994  15.9166  5.98788  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -203.994  15.9166  5.98788  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.079  15.9166  5.98788  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2563 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.674  15.9166  5.98788  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.077  15.9166  5.98788  0.02805
protocols.relax.FastRelax: {0} CMD: min  -288.876  15.4257  6.46902  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -288.876  15.4257  6.46902  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.002  15.4257  6.46902  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2484 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.905  15.4257  6.46902  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.883  15.4257  6.46902  0.154
protocols.relax.FastRelax: {0} CMD: min  -250.226  15.4614  6.479  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.226  15.4614  6.479  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.664  15.4614  6.479  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2394 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.571  15.4614  6.479  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.956  15.4614  6.479  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.337  15.43  6.50896  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.337  15.43  6.50896  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.734  15.43  6.50896  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2368 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.963  15.43  6.50896  0.55
protocols.relax.FastRelax: {0} CMD: min  -216.056  15.2418  6.71603  0.55
protocols.relax.FastRelax: {0} MRP: 2  -216.056  -216.056  15.2418  6.71603
protocols.relax.FastRelax: {0} CMD: accept_to_best  -216.056  15.2418  6.71603  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -216.056  15.2418  6.71603  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.056  15.2418  6.71603  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.767  15.2418  6.71603  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2579 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -281.229  15.2418  6.71603  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.842  15.2418  6.71603  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.501  14.8153  7.03401  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.501  14.8153  7.03401  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.022  14.8153  7.03401  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2496 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.735  14.8153  7.03401  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.167  14.8153  7.03401  0.154
protocols.relax.FastRelax: {0} CMD: min  -269.11  14.9606  6.83777  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -269.11  14.9606  6.83777  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.969  14.9606  6.83777  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2364 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.684  14.9606  6.83777  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.842  14.9606  6.83777  0.31955
protocols.relax.FastRelax: {0} CMD: min  -238.492  15.0276  6.87476  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.492  15.0276  6.87476  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.005  15.0276  6.87476  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2209 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.707  15.0276  6.87476  0.55
protocols.relax.FastRelax: {0} CMD: min  -216.508  15.1882  6.74671  0.55
protocols.relax.FastRelax: {0} MRP: 3  -216.508  -216.508  15.1882  6.74671
protocols.relax.FastRelax: {0} CMD: accept_to_best  -216.508  15.1882  6.74671  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -216.508  15.1882  6.74671  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.508  15.1882  6.74671  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.384  15.1882  6.74671  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2511 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -282.385  15.1882  6.74671  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.831  15.1882  6.74671  0.02805
protocols.relax.FastRelax: {0} CMD: min  -292.986  14.8596  7.13934  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -292.986  14.8596  7.13934  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.793  14.8596  7.13934  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2478 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.029  14.8596  7.13934  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.741  14.8596  7.13934  0.154
protocols.relax.FastRelax: {0} CMD: min  -264.023  14.9977  6.7983  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -264.023  14.9977  6.7983  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.136  14.9977  6.7983  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2360 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.663  14.9977  6.7983  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.229  14.9977  6.7983  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.528  15.0487  6.82987  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.528  15.0487  6.82987  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.213  15.0487  6.82987  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2206 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.223  15.0487  6.82987  0.55
protocols.relax.FastRelax: {0} CMD: min  -222.297  14.9407  6.68742  0.55
protocols.relax.FastRelax: {0} MRP: 4  -222.297  -222.297  14.9407  6.68742
protocols.relax.FastRelax: {0} CMD: accept_to_best  -222.297  14.9407  6.68742  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -222.297  14.9407  6.68742  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_35.pdb
protocols.relax.FastRelax: {0} CMD: repeat  77041.7  16.138  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  77041.7  16.138  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7097.24  16.138  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2897 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.5431  16.138  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -3.48775  16.138  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -248.076  16.2788  1.67987  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.076  16.2788  1.67987  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -92.127  16.2788  1.67987  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3174 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -125.113  16.2788  1.67987  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -116.57  16.2788  1.67987  0.154
protocols.relax.FastRelax: {0} CMD: min  -177.494  16.337  1.61907  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -177.494  16.337  1.61907  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -111.837  16.337  1.61907  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2872 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -118.271  16.337  1.61907  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -113.582  16.337  1.61907  0.31955
protocols.relax.FastRelax: {0} CMD: min  -175.118  16.1172  1.90238  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -175.118  16.1172  1.90238  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -127.238  16.1172  1.90238  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2760 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -128.408  16.1172  1.90238  0.55
protocols.relax.FastRelax: {0} CMD: min  -163.371  15.5956  2.85029  0.55
protocols.relax.FastRelax: {0} MRP: 0  -163.371  -163.371  15.5956  2.85029
protocols.relax.FastRelax: {0} CMD: accept_to_best  -163.371  15.5956  2.85029  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -163.371  15.5956  2.85029  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -163.371  15.5956  2.85029  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.352  15.5956  2.85029  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2998 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.987  15.5956  2.85029  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.588  15.5956  2.85029  0.02805
protocols.relax.FastRelax: {0} CMD: min  -311.585  15.3945  3.16158  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.585  15.3945  3.16158  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -162.46  15.3945  3.16158  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3044 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.887  15.3945  3.16158  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.497  15.3945  3.16158  0.154
protocols.relax.FastRelax: {0} CMD: min  -243.485  15.3404  3.20886  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.485  15.3404  3.20886  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.427  15.3404  3.20886  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2921 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.245  15.3404  3.20886  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.468  15.3404  3.20886  0.31955
protocols.relax.FastRelax: {0} CMD: min  -202.985  15.3193  3.18077  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.985  15.3193  3.18077  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -152.069  15.3193  3.18077  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2805 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -153.243  15.3193  3.18077  0.55
protocols.relax.FastRelax: {0} CMD: min  -182.826  15.3248  3.29857  0.55
protocols.relax.FastRelax: {0} MRP: 1  -182.826  -182.826  15.3248  3.29857
protocols.relax.FastRelax: {0} CMD: accept_to_best  -182.826  15.3248  3.29857  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -182.826  15.3248  3.29857  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -182.826  15.3248  3.29857  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.659  15.3248  3.29857  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2887 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.424  15.3248  3.29857  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.741  15.3248  3.29857  0.02805
protocols.relax.FastRelax: {0} CMD: min  -304.464  15.1917  3.51889  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -304.464  15.1917  3.51889  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.65  15.1917  3.51889  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2989 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.786  15.1917  3.51889  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.484  15.1917  3.51889  0.154
protocols.relax.FastRelax: {0} CMD: min  -247.695  15.1753  3.41551  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -247.695  15.1753  3.41551  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.66  15.1753  3.41551  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2934 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.774  15.1753  3.41551  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.269  15.1753  3.41551  0.31955
protocols.relax.FastRelax: {0} CMD: min  -212.345  15.1283  3.38345  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.345  15.1283  3.38345  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.061  15.1283  3.38345  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2802 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -166.338  15.1283  3.38345  0.55
protocols.relax.FastRelax: {0} CMD: min  -186.624  15.2562  3.4681  0.55
protocols.relax.FastRelax: {0} MRP: 2  -186.624  -186.624  15.2562  3.4681
protocols.relax.FastRelax: {0} CMD: accept_to_best  -186.624  15.2562  3.4681  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -186.624  15.2562  3.4681  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -186.624  15.2562  3.4681  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.928  15.2562  3.4681  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2932 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.146  15.2562  3.4681  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.984  15.2562  3.4681  0.02805
protocols.relax.FastRelax: {0} CMD: min  -323.067  15.7306  3.64478  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -323.067  15.7306  3.64478  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.151  15.7306  3.64478  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3053 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.868  15.7306  3.64478  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.907  15.7306  3.64478  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.886  15.5364  3.69267  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.886  15.5364  3.69267  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.925  15.5364  3.69267  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2811 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.38  15.5364  3.69267  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.617  15.5364  3.69267  0.31955
protocols.relax.FastRelax: {0} CMD: min  -219.695  15.5147  3.6986  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -219.695  15.5147  3.6986  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.502  15.5147  3.6986  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2670 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -170.681  15.5147  3.6986  0.55
protocols.relax.FastRelax: {0} CMD: min  -191.643  15.521  3.88067  0.55
protocols.relax.FastRelax: {0} MRP: 3  -191.643  -191.643  15.521  3.88067
protocols.relax.FastRelax: {0} CMD: accept_to_best  -191.643  15.521  3.88067  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -191.643  15.521  3.88067  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -191.643  15.521  3.88067  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.38  15.521  3.88067  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2928 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -273.334  15.521  3.88067  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.044  15.521  3.88067  0.02805
protocols.relax.FastRelax: {0} CMD: min  -326.607  15.6605  3.81395  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -326.607  15.6605  3.81395  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.53  15.6605  3.81395  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3103 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.645  15.6605  3.81395  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.058  15.6605  3.81395  0.154
protocols.relax.FastRelax: {0} CMD: min  -250.88  15.5062  3.66022  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.88  15.5062  3.66022  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.707  15.5062  3.66022  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2843 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.624  15.5062  3.66022  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.037  15.5062  3.66022  0.31955
protocols.relax.FastRelax: {0} CMD: min  -212.293  15.438  3.687  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.293  15.438  3.687  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160  15.438  3.687  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2745 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -160.002  15.438  3.687  0.55
protocols.relax.FastRelax: {0} CMD: min  -190.931  15.7471  3.82975  0.55
protocols.relax.FastRelax: {0} MRP: 4  -190.931  -191.643  15.521  3.88067
protocols.relax.FastRelax: {0} CMD: accept_to_best  -190.931  15.7471  3.82975  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -190.931  15.7471  3.82975  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_39.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71680.2  15.7112  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71680.2  15.7112  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7158.91  15.7112  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2100 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -138.447  15.7112  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -126.296  15.7112  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -265.23  15.5812  5.48654  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -265.23  15.5812  5.48654  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -137.29  15.5812  5.48654  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2558 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -169.074  15.5812  5.48654  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -162.534  15.5812  5.48654  0.154
protocols.relax.FastRelax: {0} CMD: min  -236.668  15.3991  5.95687  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.668  15.3991  5.95687  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.934  15.3991  5.95687  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2420 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.645  15.3991  5.95687  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.535  15.3991  5.95687  0.31955
protocols.relax.FastRelax: {0} CMD: min  -210.208  15.4743  6.09524  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.208  15.4743  6.09524  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.75  15.4743  6.09524  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2224 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -172.087  15.4743  6.09524  0.55
protocols.relax.FastRelax: {0} CMD: min  -210.109  15.6861  6.61221  0.55
protocols.relax.FastRelax: {0} MRP: 0  -210.109  -210.109  15.6861  6.61221
protocols.relax.FastRelax: {0} CMD: accept_to_best  -210.109  15.6861  6.61221  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -210.109  15.6861  6.61221  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.109  15.6861  6.61221  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.385  15.6861  6.61221  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2194 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -276.964  15.6861  6.61221  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.83  15.6861  6.61221  0.02805
protocols.relax.FastRelax: {0} CMD: min  -330.551  15.6485  6.13356  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -330.551  15.6485  6.13356  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.63  15.6485  6.13356  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2356 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.992  15.6485  6.13356  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.492  15.6485  6.13356  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.468  15.6779  6.13455  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.468  15.6779  6.13455  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.103  15.6779  6.13455  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2330 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.687  15.6779  6.13455  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.383  15.6779  6.13455  0.31955
protocols.relax.FastRelax: {0} CMD: min  -243.552  15.6676  6.20706  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.552  15.6676  6.20706  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.354  15.6676  6.20706  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2116 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -204.509  15.6676  6.20706  0.55
protocols.relax.FastRelax: {0} CMD: min  -223.893  15.4684  6.53782  0.55
protocols.relax.FastRelax: {0} MRP: 1  -223.893  -223.893  15.4684  6.53782
protocols.relax.FastRelax: {0} CMD: accept_to_best  -223.893  15.4684  6.53782  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -223.893  15.4684  6.53782  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.893  15.4684  6.53782  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.791  15.4684  6.53782  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2256 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -291.289  15.4684  6.53782  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.539  15.4684  6.53782  0.02805
protocols.relax.FastRelax: {0} CMD: min  -325.496  15.4777  6.3597  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -325.496  15.4777  6.3597  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.17  15.4777  6.3597  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2388 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.281  15.4777  6.3597  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.28  15.4777  6.3597  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.299  15.4619  6.36049  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.299  15.4619  6.36049  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.315  15.4619  6.36049  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2235 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.116  15.4619  6.36049  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.036  15.4619  6.36049  0.31955
protocols.relax.FastRelax: {0} CMD: min  -247.275  15.4763  6.45698  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -247.275  15.4763  6.45698  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.645  15.4763  6.45698  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2159 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.934  15.4763  6.45698  0.55
protocols.relax.FastRelax: {0} CMD: min  -232.438  15.373  6.48667  0.55
protocols.relax.FastRelax: {0} MRP: 2  -232.438  -232.438  15.373  6.48667
protocols.relax.FastRelax: {0} CMD: accept_to_best  -232.438  15.373  6.48667  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -232.438  15.373  6.48667  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.438  15.373  6.48667  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -292.043  15.373  6.48667  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2233 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -300.869  15.373  6.48667  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -299.284  15.373  6.48667  0.02805
protocols.relax.FastRelax: {0} CMD: min  -336.821  15.3572  6.25033  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -336.821  15.3572  6.25033  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.869  15.3572  6.25033  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2560 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.311  15.3572  6.25033  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.963  15.3572  6.25033  0.154
protocols.relax.FastRelax: {0} CMD: min  -287.407  15.3329  6.28146  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -287.407  15.3329  6.28146  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.755  15.3329  6.28146  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2276 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.185  15.3329  6.28146  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.336  15.3329  6.28146  0.31955
protocols.relax.FastRelax: {0} CMD: min  -258.78  15.3586  6.37422  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.78  15.3586  6.37422  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.756  15.3586  6.37422  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2208 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.76  15.3586  6.37422  0.55
protocols.relax.FastRelax: {0} CMD: min  -236.627  15.3655  6.39848  0.55
protocols.relax.FastRelax: {0} MRP: 3  -236.627  -236.627  15.3655  6.39848
protocols.relax.FastRelax: {0} CMD: accept_to_best  -236.627  15.3655  6.39848  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -236.627  15.3655  6.39848  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.627  15.3655  6.39848  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -295.205  15.3655  6.39848  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2319 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -301.474  15.3655  6.39848  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -299.649  15.3655  6.39848  0.02805
protocols.relax.FastRelax: {0} CMD: min  -342.525  15.3  6.24597  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -342.525  15.3  6.24597  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.614  15.3  6.24597  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2704 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.591  15.3  6.24597  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.152  15.3  6.24597  0.154
protocols.relax.FastRelax: {0} CMD: min  -296.115  15.2752  6.29325  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -296.115  15.2752  6.29325  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.91  15.2752  6.29325  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2356 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -258.018  15.2752  6.29325  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.025  15.2752  6.29325  0.31955
protocols.relax.FastRelax: {0} CMD: min  -262.562  15.2709  6.34514  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.562  15.2709  6.34514  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.301  15.2709  6.34514  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2212 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.325  15.2709  6.34514  0.55
protocols.relax.FastRelax: {0} CMD: min  -238.738  15.3426  6.44095  0.55
protocols.relax.FastRelax: {0} MRP: 4  -238.738  -238.738  15.3426  6.44095
protocols.relax.FastRelax: {0} CMD: accept_to_best  -238.738  15.3426  6.44095  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -238.738  15.3426  6.44095  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_33.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70897.1  10.828  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70897.1  10.828  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6755  10.828  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3548 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -81.6702  10.828  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -42.8154  10.828  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -295.666  10.2975  3.03544  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -295.666  10.2975  3.03544  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -130.542  10.2975  3.03544  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3093 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -163.397  10.2975  3.03544  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -154.715  10.2975  3.03544  0.154
protocols.relax.FastRelax: {0} CMD: min  -240.395  10.1943  3.3687  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -240.395  10.1943  3.3687  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.678  10.1943  3.3687  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3095 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.786  10.1943  3.3687  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.049  10.1943  3.3687  0.31955
protocols.relax.FastRelax: {0} CMD: min  -205.415  10.1765  3.55086  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.415  10.1765  3.55086  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.807  10.1765  3.55086  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2989 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -160.292  10.1765  3.55086  0.55
protocols.relax.FastRelax: {0} CMD: min  -209.983  10.1203  4.71357  0.55
protocols.relax.FastRelax: {0} MRP: 0  -209.983  -209.983  10.1203  4.71357
protocols.relax.FastRelax: {0} CMD: accept_to_best  -209.983  10.1203  4.71357  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -209.983  10.1203  4.71357  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.983  10.1203  4.71357  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.635  10.1203  4.71357  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3155 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -283.549  10.1203  4.71357  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -282.049  10.1203  4.71357  0.02805
protocols.relax.FastRelax: {0} CMD: min  -331.017  10.0725  4.61908  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -331.017  10.0725  4.61908  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.808  10.0725  4.61908  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3517 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.469  10.0725  4.61908  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.019  10.0725  4.61908  0.154
protocols.relax.FastRelax: {0} CMD: min  -272.483  9.97459  4.77308  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -272.483  9.97459  4.77308  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.852  9.97459  4.77308  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3257 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.561  9.97459  4.77308  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.275  9.97459  4.77308  0.31955
protocols.relax.FastRelax: {0} CMD: min  -240.635  9.96638  4.79019  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -240.635  9.96638  4.79019  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.884  9.96638  4.79019  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3060 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.845  9.96638  4.79019  0.55
protocols.relax.FastRelax: {0} CMD: min  -220.976  9.87969  5.17798  0.55
protocols.relax.FastRelax: {0} MRP: 1  -220.976  -220.976  9.87969  5.17798
protocols.relax.FastRelax: {0} CMD: accept_to_best  -220.976  9.87969  5.17798  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -220.976  9.87969  5.17798  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.976  9.87969  5.17798  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.143  9.87969  5.17798  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3338 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -294.692  9.87969  5.17798  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.152  9.87969  5.17798  0.02805
protocols.relax.FastRelax: {0} CMD: min  -330.765  9.87654  4.94575  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -330.765  9.87654  4.94575  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.493  9.87654  4.94575  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3349 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.799  9.87654  4.94575  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.77  9.87654  4.94575  0.154
protocols.relax.FastRelax: {0} CMD: min  -281.402  9.88097  5.00245  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -281.402  9.88097  5.00245  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.256  9.88097  5.00245  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3155 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.644  9.88097  5.00245  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.587  9.88097  5.00245  0.31955
protocols.relax.FastRelax: {0} CMD: min  -248.638  9.93598  5.05597  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.638  9.93598  5.05597  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.505  9.93598  5.05597  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3144 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.027  9.93598  5.05597  0.55
protocols.relax.FastRelax: {0} CMD: min  -224.574  9.91532  5.23322  0.55
protocols.relax.FastRelax: {0} MRP: 2  -224.574  -224.574  9.91532  5.23322
protocols.relax.FastRelax: {0} CMD: accept_to_best  -224.574  9.91532  5.23322  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -224.574  9.91532  5.23322  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.574  9.91532  5.23322  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.654  9.91532  5.23322  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3334 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -297.394  9.91532  5.23322  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -295.579  9.91532  5.23322  0.02805
protocols.relax.FastRelax: {0} CMD: min  -338.184  9.85645  5.14491  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -338.184  9.85645  5.14491  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.174  9.85645  5.14491  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3323 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.181  9.85645  5.14491  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.898  9.85645  5.14491  0.154
protocols.relax.FastRelax: {0} CMD: min  -278.261  9.88942  5.14269  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -278.261  9.88942  5.14269  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.649  9.88942  5.14269  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3219 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.038  9.88942  5.14269  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.837  9.88942  5.14269  0.31955
protocols.relax.FastRelax: {0} CMD: min  -249.251  9.89395  5.21914  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.251  9.89395  5.21914  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.129  9.89395  5.21914  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3194 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.403  9.89395  5.21914  0.55
protocols.relax.FastRelax: {0} CMD: min  -224.852  9.91926  5.21565  0.55
protocols.relax.FastRelax: {0} MRP: 3  -224.852  -224.852  9.91926  5.21565
protocols.relax.FastRelax: {0} CMD: accept_to_best  -224.852  9.91926  5.21565  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -224.852  9.91926  5.21565  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.852  9.91926  5.21565  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.865  9.91926  5.21565  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3326 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -294.979  9.91926  5.21565  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -292.321  9.91926  5.21565  0.02805
protocols.relax.FastRelax: {0} CMD: min  -326.499  9.81472  4.99463  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -326.499  9.81472  4.99463  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.47  9.81472  4.99463  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3332 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.975  9.81472  4.99463  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.888  9.81472  4.99463  0.154
protocols.relax.FastRelax: {0} CMD: min  -280.33  9.95223  4.97983  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.33  9.95223  4.97983  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.584  9.95223  4.97983  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3264 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.236  9.95223  4.97983  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.284  9.95223  4.97983  0.31955
protocols.relax.FastRelax: {0} CMD: min  -249.146  9.89945  4.97668  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.146  9.89945  4.97668  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.471  9.89945  4.97668  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3096 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.627  9.89945  4.97668  0.55
protocols.relax.FastRelax: {0} CMD: min  -223.989  9.892  4.99734  0.55
protocols.relax.FastRelax: {0} MRP: 4  -223.989  -224.852  9.91926  5.21565
protocols.relax.FastRelax: {0} CMD: accept_to_best  -223.989  9.892  4.99734  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -223.989  9.892  4.99734  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_48.pdb
protocols.relax.FastRelax: {0} CMD: repeat  76178.5  14.315  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  76178.5  14.315  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7699.1  14.315  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2923 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  146.826  14.315  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  176.69  14.315  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -187.663  15.2267  2.81831  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -187.663  15.2267  2.81831  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -18.4695  15.2267  2.81831  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2560 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -80.3194  15.2267  2.81831  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -73.2458  15.2267  2.81831  0.154
protocols.relax.FastRelax: {0} CMD: min  -208.126  15.3457  2.98626  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.126  15.3457  2.98626  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.899  15.3457  2.98626  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2469 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -171.375  15.3457  2.98626  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.02  15.3457  2.98626  0.31955
protocols.relax.FastRelax: {0} CMD: min  -181.194  15.5188  3.15317  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -181.194  15.5188  3.15317  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -136.757  15.5188  3.15317  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2387 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -136.044  15.5188  3.15317  0.55
protocols.relax.FastRelax: {0} CMD: min  -182.889  15.7825  3.31342  0.55
protocols.relax.FastRelax: {0} MRP: 0  -182.889  -182.889  15.7825  3.31342
protocols.relax.FastRelax: {0} CMD: accept_to_best  -182.889  15.7825  3.31342  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -182.889  15.7825  3.31342  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -182.889  15.7825  3.31342  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.51  15.7825  3.31342  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2658 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.976  15.7825  3.31342  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.534  15.7825  3.31342  0.02805
protocols.relax.FastRelax: {0} CMD: min  -308.318  15.5154  3.22274  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -308.318  15.5154  3.22274  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -167.306  15.5154  3.22274  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3050 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.113  15.5154  3.22274  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.128  15.5154  3.22274  0.154
protocols.relax.FastRelax: {0} CMD: min  -251.311  15.5383  3.26926  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.311  15.5383  3.26926  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.855  15.5383  3.26926  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2740 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -204.202  15.5383  3.26926  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.527  15.5383  3.26926  0.31955
protocols.relax.FastRelax: {0} CMD: min  -213.076  15.5875  3.24899  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.076  15.5875  3.24899  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.174  15.5875  3.24899  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2664 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -167.628  15.5875  3.24899  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.639  15.8443  3.63887  0.55
protocols.relax.FastRelax: {0} MRP: 1  -201.639  -201.639  15.8443  3.63887
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.639  15.8443  3.63887  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.639  15.8443  3.63887  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -201.639  15.8443  3.63887  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.294  15.8443  3.63887  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2845 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -283.025  15.8443  3.63887  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.812  15.8443  3.63887  0.02805
protocols.relax.FastRelax: {0} CMD: min  -313.86  15.7269  3.73746  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -313.86  15.7269  3.73746  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.666  15.7269  3.73746  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2943 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.53  15.7269  3.73746  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.872  15.7269  3.73746  0.154
protocols.relax.FastRelax: {0} CMD: min  -268.215  15.7697  3.85793  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.215  15.7697  3.85793  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.423  15.7697  3.85793  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2861 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.463  15.7697  3.85793  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.087  15.7697  3.85793  0.31955
protocols.relax.FastRelax: {0} CMD: min  -228.673  15.8148  3.82452  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.673  15.8148  3.82452  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.564  15.8148  3.82452  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2605 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.465  15.8148  3.82452  0.55
protocols.relax.FastRelax: {0} CMD: min  -202.054  15.8416  3.71605  0.55
protocols.relax.FastRelax: {0} MRP: 2  -202.054  -202.054  15.8416  3.71605
protocols.relax.FastRelax: {0} CMD: accept_to_best  -202.054  15.8416  3.71605  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -202.054  15.8416  3.71605  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.054  15.8416  3.71605  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.372  15.8416  3.71605  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2899 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.203  15.8416  3.71605  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -282.419  15.8416  3.71605  0.02805
protocols.relax.FastRelax: {0} CMD: min  -332.129  15.6346  3.76848  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -332.129  15.6346  3.76848  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.928  15.6346  3.76848  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3003 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.553  15.6346  3.76848  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.615  15.6346  3.76848  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.768  15.6866  3.73981  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.768  15.6866  3.73981  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.4  15.6866  3.73981  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2758 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.411  15.6866  3.73981  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.488  15.6866  3.73981  0.31955
protocols.relax.FastRelax: {0} CMD: min  -228.306  15.7568  3.75634  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.306  15.7568  3.75634  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.194  15.7568  3.75634  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2626 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -185.141  15.7568  3.75634  0.55
protocols.relax.FastRelax: {0} CMD: min  -202.936  15.7154  3.68612  0.55
protocols.relax.FastRelax: {0} MRP: 3  -202.936  -202.936  15.7154  3.68612
protocols.relax.FastRelax: {0} CMD: accept_to_best  -202.936  15.7154  3.68612  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -202.936  15.7154  3.68612  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.936  15.7154  3.68612  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -272.288  15.7154  3.68612  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3058 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -283.539  15.7154  3.68612  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.539  15.7154  3.68612  0.02805
protocols.relax.FastRelax: {0} CMD: min  -319.522  15.5989  3.67629  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -319.522  15.5989  3.67629  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.356  15.5989  3.67629  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2936 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.528  15.5989  3.67629  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.279  15.5989  3.67629  0.154
protocols.relax.FastRelax: {0} CMD: min  -267.415  15.6402  3.67377  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.415  15.6402  3.67377  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.129  15.6402  3.67377  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2763 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.727  15.6402  3.67377  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.279  15.6402  3.67377  0.31955
protocols.relax.FastRelax: {0} CMD: min  -232.296  15.666  3.6484  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.296  15.666  3.6484  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.981  15.666  3.6484  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2745 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -188.103  15.666  3.6484  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.359  15.6856  3.57658  0.55
protocols.relax.FastRelax: {0} MRP: 4  -204.359  -204.359  15.6856  3.57658
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.359  15.6856  3.57658  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.359  15.6856  3.57658  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_25.pdb
protocols.relax.FastRelax: {0} CMD: repeat  72295.4  15.9473  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  72295.4  15.9473  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7325.55  15.9473  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2340 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  86.6575  15.9473  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  97.2415  15.9473  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -272.707  15.6236  2.26581  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -272.707  15.6236  2.26581  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -125.01  15.6236  2.26581  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2460 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -151.076  15.6236  2.26581  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -143.017  15.6236  2.26581  0.154
protocols.relax.FastRelax: {0} CMD: min  -224.985  15.9627  2.52556  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.985  15.9627  2.52556  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.67  15.9627  2.52556  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2217 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.152  15.9627  2.52556  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.735  15.9627  2.52556  0.31955
protocols.relax.FastRelax: {0} CMD: min  -194.745  16.2312  2.7825  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.745  16.2312  2.7825  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.453  16.2312  2.7825  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2178 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -154.561  16.2312  2.7825  0.55
protocols.relax.FastRelax: {0} CMD: min  -203.341  16.6209  3.76193  0.55
protocols.relax.FastRelax: {0} MRP: 0  -203.341  -203.341  16.6209  3.76193
protocols.relax.FastRelax: {0} CMD: accept_to_best  -203.341  16.6209  3.76193  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -203.341  16.6209  3.76193  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -203.341  16.6209  3.76193  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.209  16.6209  3.76193  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2299 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.794  16.6209  3.76193  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.726  16.6209  3.76193  0.02805
protocols.relax.FastRelax: {0} CMD: min  -311.867  16.5317  4.42475  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.867  16.5317  4.42475  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.057  16.5317  4.42475  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2602 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.837  16.5317  4.42475  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.881  16.5317  4.42475  0.154
protocols.relax.FastRelax: {0} CMD: min  -262.427  16.5294  4.36277  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.427  16.5294  4.36277  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.172  16.5294  4.36277  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2375 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.881  16.5294  4.36277  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.845  16.5294  4.36277  0.31955
protocols.relax.FastRelax: {0} CMD: min  -227.438  16.5961  4.33947  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -227.438  16.5961  4.33947  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.21  16.5961  4.33947  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2220 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.728  16.5961  4.33947  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.447  16.5126  4.12504  0.55
protocols.relax.FastRelax: {0} MRP: 1  -212.447  -212.447  16.5126  4.12504
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.447  16.5126  4.12504  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.447  16.5126  4.12504  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.447  16.5126  4.12504  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.362  16.5126  4.12504  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2381 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.837  16.5126  4.12504  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -282.85  16.5126  4.12504  0.02805
protocols.relax.FastRelax: {0} CMD: min  -324.832  16.7211  4.76498  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -324.832  16.7211  4.76498  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.793  16.7211  4.76498  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2613 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.458  16.7211  4.76498  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.903  16.7211  4.76498  0.154
protocols.relax.FastRelax: {0} CMD: min  -267.864  16.643  4.44135  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.864  16.643  4.44135  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.406  16.643  4.44135  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2523 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.437  16.643  4.44135  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.141  16.643  4.44135  0.31955
protocols.relax.FastRelax: {0} CMD: min  -230.897  16.6477  4.19833  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.897  16.6477  4.19833  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.133  16.6477  4.19833  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2183 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -185.801  16.6477  4.19833  0.55
protocols.relax.FastRelax: {0} CMD: min  -214.899  16.6139  4.15896  0.55
protocols.relax.FastRelax: {0} MRP: 2  -214.899  -214.899  16.6139  4.15896
protocols.relax.FastRelax: {0} CMD: accept_to_best  -214.899  16.6139  4.15896  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -214.899  16.6139  4.15896  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -214.899  16.6139  4.15896  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.557  16.6139  4.15896  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2475 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -288.498  16.6139  4.15896  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.846  16.6139  4.15896  0.02805
protocols.relax.FastRelax: {0} CMD: min  -316.75  16.688  4.59155  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -316.75  16.688  4.59155  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.073  16.688  4.59155  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2603 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.998  16.688  4.59155  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.569  16.688  4.59155  0.154
protocols.relax.FastRelax: {0} CMD: min  -269.876  16.6034  4.46628  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -269.876  16.6034  4.46628  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.59  16.6034  4.46628  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2330 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.213  16.6034  4.46628  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.255  16.6034  4.46628  0.31955
protocols.relax.FastRelax: {0} CMD: min  -238.896  16.6571  4.36915  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.896  16.6571  4.36915  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.339  16.6571  4.36915  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2277 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.36  16.6571  4.36915  0.55
protocols.relax.FastRelax: {0} CMD: min  -215.97  16.6075  4.15169  0.55
protocols.relax.FastRelax: {0} MRP: 3  -215.97  -215.97  16.6075  4.15169
protocols.relax.FastRelax: {0} CMD: accept_to_best  -215.97  16.6075  4.15169  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -215.97  16.6075  4.15169  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.97  16.6075  4.15169  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.689  16.6075  4.15169  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2609 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -288.729  16.6075  4.15169  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.648  16.6075  4.15169  0.02805
protocols.relax.FastRelax: {0} CMD: min  -335.613  16.4801  4.74732  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -335.613  16.4801  4.74732  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.785  16.4801  4.74732  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2616 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.332  16.4801  4.74732  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.172  16.4801  4.74732  0.154
protocols.relax.FastRelax: {0} CMD: min  -274.812  16.5709  4.56682  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.812  16.5709  4.56682  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.035  16.5709  4.56682  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2432 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.882  16.5709  4.56682  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.553  16.5709  4.56682  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.189  16.6307  4.49049  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.189  16.6307  4.49049  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.514  16.6307  4.49049  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2353 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.599  16.6307  4.49049  0.55
protocols.relax.FastRelax: {0} CMD: min  -218.84  16.6281  4.41513  0.55
protocols.relax.FastRelax: {0} MRP: 4  -218.84  -218.84  16.6281  4.41513
protocols.relax.FastRelax: {0} CMD: accept_to_best  -218.84  16.6281  4.41513  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -218.84  16.6281  4.41513  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_46.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70434  18.5202  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70434  18.5202  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7412.06  18.5202  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2777 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  541.631  18.5202  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  564.845  18.5202  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -250.696  15.1453  9.45906  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.696  15.1453  9.45906  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -118.776  15.1453  9.45906  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2453 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -150.275  15.1453  9.45906  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -144.393  15.1453  9.45906  0.154
protocols.relax.FastRelax: {0} CMD: min  -201.957  15.3133  9.0851  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -201.957  15.3133  9.0851  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.415  15.3133  9.0851  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2320 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -168.988  15.3133  9.0851  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.054  15.3133  9.0851  0.31955
protocols.relax.FastRelax: {0} CMD: min  -185.289  15.4165  9.09188  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -185.289  15.4165  9.09188  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -148.299  15.4165  9.09188  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2185 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -151.923  15.4165  9.09188  0.55
protocols.relax.FastRelax: {0} CMD: min  -139.088  16.1477  7.00487  0.55
protocols.relax.FastRelax: {0} MRP: 0  -139.088  -139.088  16.1477  7.00487
protocols.relax.FastRelax: {0} CMD: accept_to_best  -139.088  16.1477  7.00487  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -139.088  16.1477  7.00487  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -139.088  16.1477  7.00487  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.032  16.1477  7.00487  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2619 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -274.091  16.1477  7.00487  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.461  16.1477  7.00487  0.02805
protocols.relax.FastRelax: {0} CMD: min  -306.152  15.8364  7.33565  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -306.152  15.8364  7.33565  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.096  15.8364  7.33565  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2802 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.614  15.8364  7.33565  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.761  15.8364  7.33565  0.154
protocols.relax.FastRelax: {0} CMD: min  -260.723  15.8837  7.387  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.723  15.8837  7.387  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.609  15.8837  7.387  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2482 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.045  15.8837  7.387  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.429  15.8837  7.387  0.31955
protocols.relax.FastRelax: {0} CMD: min  -228.908  15.879  7.40869  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.908  15.879  7.40869  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.029  15.879  7.40869  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2324 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.612  15.879  7.40869  0.55
protocols.relax.FastRelax: {0} CMD: min  -222.453  16.2683  6.92942  0.55
protocols.relax.FastRelax: {0} MRP: 1  -222.453  -222.453  16.2683  6.92942
protocols.relax.FastRelax: {0} CMD: accept_to_best  -222.453  16.2683  6.92942  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -222.453  16.2683  6.92942  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.453  16.2683  6.92942  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -272.705  16.2683  6.92942  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2516 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.207  16.2683  6.92942  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -282.015  16.2683  6.92942  0.02805
protocols.relax.FastRelax: {0} CMD: min  -319.972  16.0005  7.10405  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -319.972  16.0005  7.10405  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.885  16.0005  7.10405  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2659 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.019  16.0005  7.10405  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.949  16.0005  7.10405  0.154
protocols.relax.FastRelax: {0} CMD: min  -268.028  16.1349  6.87261  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.028  16.1349  6.87261  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.676  16.1349  6.87261  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2297 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.335  16.1349  6.87261  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.581  16.1349  6.87261  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.769  16.2179  6.79629  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.769  16.2179  6.79629  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.839  16.2179  6.79629  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2233 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.104  16.2179  6.79629  0.55
protocols.relax.FastRelax: {0} CMD: min  -223.824  16.2414  7.01736  0.55
protocols.relax.FastRelax: {0} MRP: 2  -223.824  -223.824  16.2414  7.01736
protocols.relax.FastRelax: {0} CMD: accept_to_best  -223.824  16.2414  7.01736  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -223.824  16.2414  7.01736  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.824  16.2414  7.01736  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.845  16.2414  7.01736  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2412 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -285.691  16.2414  7.01736  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.596  16.2414  7.01736  0.02805
protocols.relax.FastRelax: {0} CMD: min  -320.538  16.3451  6.55106  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -320.538  16.3451  6.55106  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.409  16.3451  6.55106  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2804 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.059  16.3451  6.55106  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.283  16.3451  6.55106  0.154
protocols.relax.FastRelax: {0} CMD: min  -273.078  16.4449  6.40452  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.078  16.4449  6.40452  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.273  16.4449  6.40452  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2471 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.933  16.4449  6.40452  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.185  16.4449  6.40452  0.31955
protocols.relax.FastRelax: {0} CMD: min  -245.736  16.5038  6.38404  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.736  16.5038  6.38404  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.047  16.5038  6.38404  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2284 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.384  16.5038  6.38404  0.55
protocols.relax.FastRelax: {0} CMD: min  -235.403  16.6268  6.35204  0.55
protocols.relax.FastRelax: {0} MRP: 3  -235.403  -235.403  16.6268  6.35204
protocols.relax.FastRelax: {0} CMD: accept_to_best  -235.403  16.6268  6.35204  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -235.403  16.6268  6.35204  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.403  16.6268  6.35204  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -290.37  16.6268  6.35204  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2603 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -302.198  16.6268  6.35204  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -300.262  16.6268  6.35204  0.02805
protocols.relax.FastRelax: {0} CMD: min  -347.861  16.636  6.15388  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -347.861  16.636  6.15388  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.333  16.636  6.15388  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2985 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.993  16.636  6.15388  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.238  16.636  6.15388  0.154
protocols.relax.FastRelax: {0} CMD: min  -291.827  16.6736  6.22046  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -291.827  16.6736  6.22046  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.552  16.6736  6.22046  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2833 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.469  16.6736  6.22046  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.46  16.6736  6.22046  0.31955
protocols.relax.FastRelax: {0} CMD: min  -255.428  16.6376  6.29794  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.428  16.6376  6.29794  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.345  16.6376  6.29794  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2616 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.054  16.6376  6.29794  0.55
protocols.relax.FastRelax: {0} CMD: min  -237.38  16.6899  6.41146  0.55
protocols.relax.FastRelax: {0} MRP: 4  -237.38  -237.38  16.6899  6.41146
protocols.relax.FastRelax: {0} CMD: accept_to_best  -237.38  16.6899  6.41146  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -237.38  16.6899  6.41146  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_28.pdb
protocols.relax.FastRelax: {0} CMD: repeat  81522.3  16.5396  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  81522.3  16.5396  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7978.92  16.5396  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3019 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  205.613  16.5396  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  254.683  16.5396  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -249.492  16.3939  2.99017  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.492  16.3939  2.99017  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -76.2643  16.3939  2.99017  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3137 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -104.876  16.3939  2.99017  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -94.8509  16.3939  2.99017  0.154
protocols.relax.FastRelax: {0} CMD: min  -204.762  17.0516  3.9121  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.762  17.0516  3.9121  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -147.964  17.0516  3.9121  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2892 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -149.895  17.0516  3.9121  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -145.474  17.0516  3.9121  0.31955
protocols.relax.FastRelax: {0} CMD: min  -157.66  17.045  3.78314  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -157.66  17.045  3.78314  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -96.2177  17.045  3.78314  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2691 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -97.2207  17.045  3.78314  0.55
protocols.relax.FastRelax: {0} CMD: min  -164.417  17.4282  5.22968  0.55
protocols.relax.FastRelax: {0} MRP: 0  -164.417  -164.417  17.4282  5.22968
protocols.relax.FastRelax: {0} CMD: accept_to_best  -164.417  17.4282  5.22968  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -164.417  17.4282  5.22968  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -164.417  17.4282  5.22968  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.986  17.4282  5.22968  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2922 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -255.579  17.4282  5.22968  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.477  17.4282  5.22968  0.02805
protocols.relax.FastRelax: {0} CMD: min  -297.366  17.1856  5.43662  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -297.366  17.1856  5.43662  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -147.571  17.1856  5.43662  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2900 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.967  17.1856  5.43662  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.374  17.1856  5.43662  0.154
protocols.relax.FastRelax: {0} CMD: min  -237.49  17.1559  5.46444  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.49  17.1559  5.46444  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.446  17.1559  5.46444  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2697 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.67  17.1559  5.46444  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.043  17.1559  5.46444  0.31955
protocols.relax.FastRelax: {0} CMD: min  -200.901  17.1823  5.47521  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.901  17.1823  5.47521  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.562  17.1823  5.47521  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2605 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -153.633  17.1823  5.47521  0.55
protocols.relax.FastRelax: {0} CMD: min  -179.096  16.949  5.1872  0.55
protocols.relax.FastRelax: {0} MRP: 1  -179.096  -179.096  16.949  5.1872
protocols.relax.FastRelax: {0} CMD: accept_to_best  -179.096  16.949  5.1872  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -179.096  16.949  5.1872  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -179.096  16.949  5.1872  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.398  16.949  5.1872  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2729 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -261.872  16.949  5.1872  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.852  16.949  5.1872  0.02805
protocols.relax.FastRelax: {0} CMD: min  -309.058  16.2651  5.41608  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -309.058  16.2651  5.41608  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.747  16.2651  5.41608  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2803 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.71  16.2651  5.41608  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.522  16.2651  5.41608  0.154
protocols.relax.FastRelax: {0} CMD: min  -244.381  16.4583  5.4708  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.381  16.4583  5.4708  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.122  16.4583  5.4708  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2722 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.718  16.4583  5.4708  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.099  16.4583  5.4708  0.31955
protocols.relax.FastRelax: {0} CMD: min  -206.16  16.6313  5.44784  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -206.16  16.6313  5.44784  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.247  16.6313  5.44784  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2622 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -159.662  16.6313  5.44784  0.55
protocols.relax.FastRelax: {0} CMD: min  -184.325  16.7177  4.95021  0.55
protocols.relax.FastRelax: {0} MRP: 2  -184.325  -184.325  16.7177  4.95021
protocols.relax.FastRelax: {0} CMD: accept_to_best  -184.325  16.7177  4.95021  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -184.325  16.7177  4.95021  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -184.325  16.7177  4.95021  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.736  16.7177  4.95021  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2971 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.624  16.7177  4.95021  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.122  16.7177  4.95021  0.02805
protocols.relax.FastRelax: {0} CMD: min  -313.259  16.2627  5.12192  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -313.259  16.2627  5.12192  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.211  16.2627  5.12192  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2865 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.993  16.2627  5.12192  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.078  16.2627  5.12192  0.154
protocols.relax.FastRelax: {0} CMD: min  -253.498  16.3719  5.29496  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.498  16.3719  5.29496  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.163  16.3719  5.29496  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2769 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.708  16.3719  5.29496  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.079  16.3719  5.29496  0.31955
protocols.relax.FastRelax: {0} CMD: min  -217  16.524  5.2918  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217  16.524  5.2918  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.142  16.524  5.2918  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2639 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -170.199  16.524  5.2918  0.55
protocols.relax.FastRelax: {0} CMD: min  -192.571  16.7186  5.37281  0.55
protocols.relax.FastRelax: {0} MRP: 3  -192.571  -192.571  16.7186  5.37281
protocols.relax.FastRelax: {0} CMD: accept_to_best  -192.571  16.7186  5.37281  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -192.571  16.7186  5.37281  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -192.571  16.7186  5.37281  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.923  16.7186  5.37281  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2876 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -275.037  16.7186  5.37281  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.401  16.7186  5.37281  0.02805
protocols.relax.FastRelax: {0} CMD: min  -326.819  16.3671  5.45339  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -326.819  16.3671  5.45339  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.488  16.3671  5.45339  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2927 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.928  16.3671  5.45339  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.296  16.3671  5.45339  0.154
protocols.relax.FastRelax: {0} CMD: min  -261.304  16.3839  5.48395  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.304  16.3839  5.48395  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.033  16.3839  5.48395  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2731 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.512  16.3839  5.48395  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.743  16.3839  5.48395  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.17  16.475  5.53498  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.17  16.475  5.53498  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.951  16.475  5.53498  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2612 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -172.35  16.475  5.53498  0.55
protocols.relax.FastRelax: {0} CMD: min  -197.96  16.6569  5.49557  0.55
protocols.relax.FastRelax: {0} MRP: 4  -197.96  -197.96  16.6569  5.49557
protocols.relax.FastRelax: {0} CMD: accept_to_best  -197.96  16.6569  5.49557  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -197.96  16.6569  5.49557  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_19.pdb
protocols.relax.FastRelax: {0} CMD: repeat  69735.7  10.3377  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  69735.7  10.3377  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7246.06  10.3377  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2770 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  188.822  10.3377  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  238.563  10.3377  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -239.619  10.2119  3.7427  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.619  10.2119  3.7427  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -89.7285  10.2119  3.7427  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2398 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -131.411  10.2119  3.7427  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -124.339  10.2119  3.7427  0.154
protocols.relax.FastRelax: {0} CMD: min  -185.84  10.0229  4.30217  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -185.84  10.0229  4.30217  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -138.334  10.0229  4.30217  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2327 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -140.801  10.0229  4.30217  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -137.196  10.0229  4.30217  0.31955
protocols.relax.FastRelax: {0} CMD: min  -155.388  9.90223  4.73308  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -155.388  9.90223  4.73308  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -108.585  9.90223  4.73308  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2224 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -108.989  9.90223  4.73308  0.55
protocols.relax.FastRelax: {0} CMD: min  -167.016  9.93231  4.38722  0.55
protocols.relax.FastRelax: {0} MRP: 0  -167.016  -167.016  9.93231  4.38722
protocols.relax.FastRelax: {0} CMD: accept_to_best  -167.016  9.93231  4.38722  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -167.016  9.93231  4.38722  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -167.016  9.93231  4.38722  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.388  9.93231  4.38722  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2520 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -249.075  9.93231  4.38722  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.956  9.93231  4.38722  0.02805
protocols.relax.FastRelax: {0} CMD: min  -301.44  10.1953  4.06245  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -301.44  10.1953  4.06245  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.139  10.1953  4.06245  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2506 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.746  10.1953  4.06245  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.32  10.1953  4.06245  0.154
protocols.relax.FastRelax: {0} CMD: min  -241.624  10.2269  4.22879  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.624  10.2269  4.22879  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.171  10.2269  4.22879  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2276 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.85  10.2269  4.22879  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.363  10.2269  4.22879  0.31955
protocols.relax.FastRelax: {0} CMD: min  -207.531  10.0607  4.31517  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -207.531  10.0607  4.31517  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -165.772  10.0607  4.31517  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2271 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -166.015  10.0607  4.31517  0.55
protocols.relax.FastRelax: {0} CMD: min  -190.196  11.1346  4.52166  0.55
protocols.relax.FastRelax: {0} MRP: 1  -190.196  -190.196  11.1346  4.52166
protocols.relax.FastRelax: {0} CMD: accept_to_best  -190.196  11.1346  4.52166  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -190.196  11.1346  4.52166  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -190.196  11.1346  4.52166  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.553  11.1346  4.52166  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2689 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -265.444  11.1346  4.52166  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.224  11.1346  4.52166  0.02805
protocols.relax.FastRelax: {0} CMD: min  -303.258  11.4119  4.70731  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -303.258  11.4119  4.70731  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.37  11.4119  4.70731  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2837 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.229  11.4119  4.70731  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.929  11.4119  4.70731  0.154
protocols.relax.FastRelax: {0} CMD: min  -252.07  11.2971  4.64114  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.07  11.2971  4.64114  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.853  11.2971  4.64114  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2530 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.021  11.2971  4.64114  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.718  11.2971  4.64114  0.31955
protocols.relax.FastRelax: {0} CMD: min  -217.091  11.3516  4.67099  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.091  11.3516  4.67099  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.821  11.3516  4.67099  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2441 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -173.004  11.3516  4.67099  0.55
protocols.relax.FastRelax: {0} CMD: min  -193.141  11.5017  4.76738  0.55
protocols.relax.FastRelax: {0} MRP: 2  -193.141  -193.141  11.5017  4.76738
protocols.relax.FastRelax: {0} CMD: accept_to_best  -193.141  11.5017  4.76738  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -193.141  11.5017  4.76738  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.141  11.5017  4.76738  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.559  11.5017  4.76738  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2730 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.075  11.5017  4.76738  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.193  11.5017  4.76738  0.02805
protocols.relax.FastRelax: {0} CMD: min  -300.252  11.6156  4.9299  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -300.252  11.6156  4.9299  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.277  11.6156  4.9299  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2874 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.769  11.6156  4.9299  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.173  11.6156  4.9299  0.154
protocols.relax.FastRelax: {0} CMD: min  -252.045  11.704  4.90901  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.045  11.704  4.90901  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.704  11.704  4.90901  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2606 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.007  11.704  4.90901  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.7  11.704  4.90901  0.31955
protocols.relax.FastRelax: {0} CMD: min  -214.592  11.5695  4.80096  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -214.592  11.5695  4.80096  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.534  11.5695  4.80096  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2515 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -169.801  11.5695  4.80096  0.55
protocols.relax.FastRelax: {0} CMD: min  -191.938  11.6555  4.85142  0.55
protocols.relax.FastRelax: {0} MRP: 3  -191.938  -193.141  11.5017  4.76738
protocols.relax.FastRelax: {0} CMD: accept_to_best  -191.938  11.6555  4.85142  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -191.938  11.6555  4.85142  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -191.938  11.6555  4.85142  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.873  11.6555  4.85142  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2896 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.245  11.6555  4.85142  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.882  11.6555  4.85142  0.02805
protocols.relax.FastRelax: {0} CMD: min  -325.307  12.3013  5.49537  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -325.307  12.3013  5.49537  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.808  12.3013  5.49537  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3109 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.958  12.3013  5.49537  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.023  12.3013  5.49537  0.154
protocols.relax.FastRelax: {0} CMD: min  -257.211  12.6246  5.76058  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.211  12.6246  5.76058  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.571  12.6246  5.76058  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3009 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.944  12.6246  5.76058  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.165  12.6246  5.76058  0.31955
protocols.relax.FastRelax: {0} CMD: min  -217.824  12.6542  5.74837  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.824  12.6542  5.74837  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.067  12.6542  5.74837  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2971 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -167.872  12.6542  5.74837  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.646  12.6675  5.85361  0.55
protocols.relax.FastRelax: {0} MRP: 4  -201.646  -201.646  12.6675  5.85361
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.646  12.6675  5.85361  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.646  12.6675  5.85361  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_43.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71011.5  13.5897  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71011.5  13.5897  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6625.19  13.5897  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3016 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  161.245  13.5897  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  194.383  13.5897  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -264.037  13.282  2.03394  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -264.037  13.282  2.03394  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -141.093  13.282  2.03394  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2860 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -155.468  13.282  2.03394  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -148.481  13.282  2.03394  0.154
protocols.relax.FastRelax: {0} CMD: min  -211.024  13.3061  2.31818  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.024  13.3061  2.31818  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.668  13.3061  2.31818  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2677 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -167.563  13.3061  2.31818  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.104  13.3061  2.31818  0.31955
protocols.relax.FastRelax: {0} CMD: min  -173.593  13.2823  2.3557  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -173.593  13.2823  2.3557  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -125.982  13.2823  2.3557  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2525 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -126.578  13.2823  2.3557  0.55
protocols.relax.FastRelax: {0} CMD: min  -183.918  13.8088  3.9229  0.55
protocols.relax.FastRelax: {0} MRP: 0  -183.918  -183.918  13.8088  3.9229
protocols.relax.FastRelax: {0} CMD: accept_to_best  -183.918  13.8088  3.9229  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -183.918  13.8088  3.9229  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -183.918  13.8088  3.9229  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.933  13.8088  3.9229  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2721 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.509  13.8088  3.9229  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.242  13.8088  3.9229  0.02805
protocols.relax.FastRelax: {0} CMD: min  -311.289  13.9834  3.9892  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.289  13.9834  3.9892  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -136.638  13.9834  3.9892  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3060 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -182.298  13.9834  3.9892  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.662  13.9834  3.9892  0.154
protocols.relax.FastRelax: {0} CMD: min  -255.161  13.9677  4.34356  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.161  13.9677  4.34356  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.734  13.9677  4.34356  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2820 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.724  13.9677  4.34356  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.41  13.9677  4.34356  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.244  13.9308  4.29501  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.244  13.9308  4.29501  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.138  13.9308  4.29501  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2680 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.76  13.9308  4.29501  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.638  14.554  4.98667  0.55
protocols.relax.FastRelax: {0} MRP: 1  -204.638  -204.638  14.554  4.98667
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.638  14.554  4.98667  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.638  14.554  4.98667  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.638  14.554  4.98667  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.62  14.554  4.98667  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2979 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -285.02  14.554  4.98667  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.904  14.554  4.98667  0.02805
protocols.relax.FastRelax: {0} CMD: min  -333.009  14.6335  5.10275  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -333.009  14.6335  5.10275  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.894  14.6335  5.10275  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3008 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.084  14.6335  5.10275  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.647  14.6335  5.10275  0.154
protocols.relax.FastRelax: {0} CMD: min  -267.968  14.5448  5.05139  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.968  14.5448  5.05139  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.606  14.5448  5.05139  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2860 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.009  14.5448  5.05139  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.702  14.5448  5.05139  0.31955
protocols.relax.FastRelax: {0} CMD: min  -233.573  14.5624  5.14504  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -233.573  14.5624  5.14504  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.588  14.5624  5.14504  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2627 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -190.718  14.5624  5.14504  0.55
protocols.relax.FastRelax: {0} CMD: min  -220.722  14.6609  5.36657  0.55
protocols.relax.FastRelax: {0} MRP: 2  -220.722  -220.722  14.6609  5.36657
protocols.relax.FastRelax: {0} CMD: accept_to_best  -220.722  14.6609  5.36657  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -220.722  14.6609  5.36657  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.722  14.6609  5.36657  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.237  14.6609  5.36657  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3009 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -290.351  14.6609  5.36657  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.841  14.6609  5.36657  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.993  14.7779  5.39285  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.993  14.7779  5.39285  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.602  14.7779  5.39285  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3030 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.17  14.7779  5.39285  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.868  14.7779  5.39285  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.101  14.7541  5.46664  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.101  14.7541  5.46664  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.59  14.7541  5.46664  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2850 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.853  14.7541  5.46664  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.985  14.7541  5.46664  0.31955
protocols.relax.FastRelax: {0} CMD: min  -245.649  14.7532  5.4552  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.649  14.7532  5.4552  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.634  14.7532  5.4552  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2707 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.652  14.7532  5.4552  0.55
protocols.relax.FastRelax: {0} CMD: min  -228.986  15.0486  5.59  0.55
protocols.relax.FastRelax: {0} MRP: 3  -228.986  -228.986  15.0486  5.59
protocols.relax.FastRelax: {0} CMD: accept_to_best  -228.986  15.0486  5.59  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -228.986  15.0486  5.59  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.986  15.0486  5.59  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.737  15.0486  5.59  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3177 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -302.573  15.0486  5.59  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -299.959  15.0486  5.59  0.02805
protocols.relax.FastRelax: {0} CMD: min  -355.811  15.2008  5.68286  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -355.811  15.2008  5.68286  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.409  15.2008  5.68286  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2770 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.285  15.2008  5.68286  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.497  15.2008  5.68286  0.154
protocols.relax.FastRelax: {0} CMD: min  -293.192  15.1177  5.64826  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -293.192  15.1177  5.64826  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.676  15.1177  5.64826  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2753 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.136  15.1177  5.64826  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.819  15.1177  5.64826  0.31955
protocols.relax.FastRelax: {0} CMD: min  -257.466  15.0323  5.57154  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.466  15.0323  5.57154  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.846  15.0323  5.57154  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2698 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.792  15.0323  5.57154  0.55
protocols.relax.FastRelax: {0} CMD: min  -234.622  14.9432  5.48526  0.55
protocols.relax.FastRelax: {0} MRP: 4  -234.622  -234.622  14.9432  5.48526
protocols.relax.FastRelax: {0} CMD: accept_to_best  -234.622  14.9432  5.48526  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -234.622  14.9432  5.48526  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_29.pdb
protocols.relax.FastRelax: {0} CMD: repeat  68182.5  12.539  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  68182.5  12.539  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7502.98  12.539  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3119 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  119.51  12.539  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  142.275  12.539  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -294.635  12.8037  3.30107  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -294.635  12.8037  3.30107  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -103.58  12.8037  3.30107  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3571 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -155.95  12.8037  3.30107  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -147.495  12.8037  3.30107  0.154
protocols.relax.FastRelax: {0} CMD: min  -257.148  13.123  3.48091  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.148  13.123  3.48091  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.597  13.123  3.48091  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3410 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.074  13.123  3.48091  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.897  13.123  3.48091  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.472  13.0345  3.25589  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.472  13.0345  3.25589  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.953  13.0345  3.25589  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3043 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -171.052  13.0345  3.25589  0.55
protocols.relax.FastRelax: {0} CMD: min  -219.58  13.0115  2.85373  0.55
protocols.relax.FastRelax: {0} MRP: 0  -219.58  -219.58  13.0115  2.85373
protocols.relax.FastRelax: {0} CMD: accept_to_best  -219.58  13.0115  2.85373  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -219.58  13.0115  2.85373  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -219.58  13.0115  2.85373  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -291.668  13.0115  2.85373  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3329 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -308.962  13.0115  2.85373  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -304.767  13.0115  2.85373  0.02805
protocols.relax.FastRelax: {0} CMD: min  -362.462  13.1968  3.59094  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -362.462  13.1968  3.59094  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.392  13.1968  3.59094  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3688 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.756  13.1968  3.59094  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.426  13.1968  3.59094  0.154
protocols.relax.FastRelax: {0} CMD: min  -286.667  13.2127  3.34691  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -286.667  13.2127  3.34691  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.621  13.2127  3.34691  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3396 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.364  13.2127  3.34691  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.163  13.2127  3.34691  0.31955
protocols.relax.FastRelax: {0} CMD: min  -255.56  13.1692  3.22846  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.56  13.1692  3.22846  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.975  13.1692  3.22846  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3176 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.384  13.1692  3.22846  0.55
protocols.relax.FastRelax: {0} CMD: min  -234.424  12.938  3.08226  0.55
protocols.relax.FastRelax: {0} MRP: 1  -234.424  -234.424  12.938  3.08226
protocols.relax.FastRelax: {0} CMD: accept_to_best  -234.424  12.938  3.08226  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -234.424  12.938  3.08226  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -234.424  12.938  3.08226  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -309.337  12.938  3.08226  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3305 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -324.038  12.938  3.08226  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -320.814  12.938  3.08226  0.02805
protocols.relax.FastRelax: {0} CMD: min  -379.258  12.8564  3.43925  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -379.258  12.8564  3.43925  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.64  12.8564  3.43925  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3611 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.863  12.8564  3.43925  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.946  12.8564  3.43925  0.154
protocols.relax.FastRelax: {0} CMD: min  -304.337  13.0087  3.36123  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -304.337  13.0087  3.36123  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.583  13.0087  3.36123  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3396 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -255.759  13.0087  3.36123  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.828  13.0087  3.36123  0.31955
protocols.relax.FastRelax: {0} CMD: min  -262.653  12.9754  3.22841  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.653  12.9754  3.22841  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.835  12.9754  3.22841  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3052 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.245  12.9754  3.22841  0.55
protocols.relax.FastRelax: {0} CMD: min  -236.569  13.0598  3.29419  0.55
protocols.relax.FastRelax: {0} MRP: 2  -236.569  -236.569  13.0598  3.29419
protocols.relax.FastRelax: {0} CMD: accept_to_best  -236.569  13.0598  3.29419  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -236.569  13.0598  3.29419  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.569  13.0598  3.29419  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -313.157  13.0598  3.29419  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3420 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -328.752  13.0598  3.29419  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -325.67  13.0598  3.29419  0.02805
protocols.relax.FastRelax: {0} CMD: min  -385.003  13.2194  3.74738  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -385.003  13.2194  3.74738  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.186  13.2194  3.74738  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3696 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -252.645  13.2194  3.74738  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.447  13.2194  3.74738  0.154
protocols.relax.FastRelax: {0} CMD: min  -309.694  13.2269  3.67619  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -309.694  13.2269  3.67619  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.08  13.2269  3.67619  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3463 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.443  13.2269  3.67619  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.552  13.2269  3.67619  0.31955
protocols.relax.FastRelax: {0} CMD: min  -268.992  13.2311  3.65008  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.992  13.2311  3.65008  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.536  13.2311  3.65008  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3244 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.714  13.2311  3.65008  0.55
protocols.relax.FastRelax: {0} CMD: min  -237.291  13.1286  3.6166  0.55
protocols.relax.FastRelax: {0} MRP: 3  -237.291  -237.291  13.1286  3.6166
protocols.relax.FastRelax: {0} CMD: accept_to_best  -237.291  13.1286  3.6166  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -237.291  13.1286  3.6166  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.291  13.1286  3.6166  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -314.809  13.1286  3.6166  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3534 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -330.627  13.1286  3.6166  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -327.62  13.1286  3.6166  0.02805
protocols.relax.FastRelax: {0} CMD: min  -382.933  12.9618  3.60138  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -382.933  12.9618  3.60138  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.569  12.9618  3.60138  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3789 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -253.349  12.9618  3.60138  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.813  12.9618  3.60138  0.154
protocols.relax.FastRelax: {0} CMD: min  -311.439  13.1743  3.65325  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.439  13.1743  3.65325  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.352  13.1743  3.65325  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3804 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -262.686  13.1743  3.65325  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.862  13.1743  3.65325  0.31955
protocols.relax.FastRelax: {0} CMD: min  -268.273  13.1524  3.60871  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.273  13.1524  3.60871  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.258  13.1524  3.60871  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3459 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.803  13.1524  3.60871  0.55
protocols.relax.FastRelax: {0} CMD: min  -243.78  13.1722  3.51171  0.55
protocols.relax.FastRelax: {0} MRP: 4  -243.78  -243.78  13.1722  3.51171
protocols.relax.FastRelax: {0} CMD: accept_to_best  -243.78  13.1722  3.51171  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -243.78  13.1722  3.51171  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_13.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71897.4  9.04924  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71897.4  9.04924  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7326.26  9.04924  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2529 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  85.7873  9.04924  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  98.6524  9.04924  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -202.827  9.42693  3.53756  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.827  9.42693  3.53756  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  152.847  9.42693  3.53756  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2796 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -144.27  9.42693  3.53756  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -137.512  9.42693  3.53756  0.154
protocols.relax.FastRelax: {0} CMD: min  -211.679  9.66451  4.04403  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.679  9.66451  4.04403  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.685  9.66451  4.04403  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2719 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -166.223  9.66451  4.04403  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -162.547  9.66451  4.04403  0.31955
protocols.relax.FastRelax: {0} CMD: min  -177.347  9.64374  4.07751  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -177.347  9.64374  4.07751  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -130.727  9.64374  4.07751  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2575 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -132.944  9.64374  4.07751  0.55
protocols.relax.FastRelax: {0} CMD: min  -179.763  9.56185  4.68298  0.55
protocols.relax.FastRelax: {0} MRP: 0  -179.763  -179.763  9.56185  4.68298
protocols.relax.FastRelax: {0} CMD: accept_to_best  -179.763  9.56185  4.68298  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -179.763  9.56185  4.68298  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -179.763  9.56185  4.68298  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.454  9.56185  4.68298  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2972 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -264.567  9.56185  4.68298  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.088  9.56185  4.68298  0.02805
protocols.relax.FastRelax: {0} CMD: min  -324.588  10.1325  5.69529  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -324.588  10.1325  5.69529  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.589  10.1325  5.69529  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3243 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.649  10.1325  5.69529  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.083  10.1325  5.69529  0.154
protocols.relax.FastRelax: {0} CMD: min  -267.436  10.3399  6.23374  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.436  10.3399  6.23374  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.887  10.3399  6.23374  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2995 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.106  10.3399  6.23374  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.228  10.3399  6.23374  0.31955
protocols.relax.FastRelax: {0} CMD: min  -232.497  10.2858  6.24904  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.497  10.2858  6.24904  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.928  10.2858  6.24904  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2814 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.717  10.2858  6.24904  0.55
protocols.relax.FastRelax: {0} CMD: min  -213.01  10.5219  6.49475  0.55
protocols.relax.FastRelax: {0} MRP: 1  -213.01  -213.01  10.5219  6.49475
protocols.relax.FastRelax: {0} CMD: accept_to_best  -213.01  10.5219  6.49475  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -213.01  10.5219  6.49475  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.01  10.5219  6.49475  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -282.715  10.5219  6.49475  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2983 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -288.927  10.5219  6.49475  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.385  10.5219  6.49475  0.02805
protocols.relax.FastRelax: {0} CMD: min  -347.111  10.6882  6.8718  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -347.111  10.6882  6.8718  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.762  10.6882  6.8718  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3325 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.373  10.6882  6.8718  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.906  10.6882  6.8718  0.154
protocols.relax.FastRelax: {0} CMD: min  -282.169  10.614  6.69338  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.169  10.614  6.69338  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.462  10.614  6.69338  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2842 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.501  10.614  6.69338  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.834  10.614  6.69338  0.31955
protocols.relax.FastRelax: {0} CMD: min  -243.692  10.5231  6.55623  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.692  10.5231  6.55623  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.143  10.5231  6.55623  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2809 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.023  10.5231  6.55623  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.168  10.3732  6.31735  0.55
protocols.relax.FastRelax: {0} MRP: 2  -217.168  -217.168  10.3732  6.31735
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.168  10.3732  6.31735  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.168  10.3732  6.31735  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.168  10.3732  6.31735  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.847  10.3732  6.31735  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3085 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -296.32  10.3732  6.31735  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.555  10.3732  6.31735  0.02805
protocols.relax.FastRelax: {0} CMD: min  -344.088  10.466  6.53739  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -344.088  10.466  6.53739  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.097  10.466  6.53739  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3295 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.075  10.466  6.53739  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.295  10.466  6.53739  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.588  10.3288  6.30405  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.588  10.3288  6.30405  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.462  10.3288  6.30405  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2933 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.254  10.3288  6.30405  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.433  10.3288  6.30405  0.31955
protocols.relax.FastRelax: {0} CMD: min  -244.132  10.3372  6.30483  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.132  10.3372  6.30483  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.231  10.3372  6.30483  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2786 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.316  10.3372  6.30483  0.55
protocols.relax.FastRelax: {0} CMD: min  -218.782  10.1888  6.12879  0.55
protocols.relax.FastRelax: {0} MRP: 3  -218.782  -218.782  10.1888  6.12879
protocols.relax.FastRelax: {0} CMD: accept_to_best  -218.782  10.1888  6.12879  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -218.782  10.1888  6.12879  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218.782  10.1888  6.12879  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.336  10.1888  6.12879  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3158 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -299.881  10.1888  6.12879  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -297.846  10.1888  6.12879  0.02805
protocols.relax.FastRelax: {0} CMD: min  -356.197  10.3149  6.51338  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -356.197  10.3149  6.51338  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.461  10.3149  6.51338  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3247 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.47  10.3149  6.51338  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.822  10.3149  6.51338  0.154
protocols.relax.FastRelax: {0} CMD: min  -288.044  10.2364  6.28403  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -288.044  10.2364  6.28403  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.213  10.2364  6.28403  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2920 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.811  10.2364  6.28403  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.237  10.2364  6.28403  0.31955
protocols.relax.FastRelax: {0} CMD: min  -247.3  10.189  6.20027  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -247.3  10.189  6.20027  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.81  10.189  6.20027  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2874 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.46  10.189  6.20027  0.55
protocols.relax.FastRelax: {0} CMD: min  -227.104  10.1971  6.15537  0.55
protocols.relax.FastRelax: {0} MRP: 4  -227.104  -227.104  10.1971  6.15537
protocols.relax.FastRelax: {0} CMD: accept_to_best  -227.104  10.1971  6.15537  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -227.104  10.1971  6.15537  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_26.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70663.1  13.94  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70663.1  13.94  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6588.38  13.94  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2480 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -149.871  13.94  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -134.924  13.94  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -295.05  13.6561  3.34165  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -295.05  13.6561  3.34165  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -127.723  13.6561  3.34165  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2779 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -156.388  13.6561  3.34165  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -147.544  13.6561  3.34165  0.154
protocols.relax.FastRelax: {0} CMD: min  -250.832  13.4832  4.14328  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.832  13.4832  4.14328  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.509  13.4832  4.14328  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2731 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.347  13.4832  4.14328  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.873  13.4832  4.14328  0.31955
protocols.relax.FastRelax: {0} CMD: min  -214.983  13.5045  4.12393  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -214.983  13.5045  4.12393  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.225  13.5045  4.12393  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2460 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -169.292  13.5045  4.12393  0.55
protocols.relax.FastRelax: {0} CMD: min  -223.885  13.4807  4.59754  0.55
protocols.relax.FastRelax: {0} MRP: 0  -223.885  -223.885  13.4807  4.59754
protocols.relax.FastRelax: {0} CMD: accept_to_best  -223.885  13.4807  4.59754  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -223.885  13.4807  4.59754  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.885  13.4807  4.59754  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.03  13.4807  4.59754  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2895 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -304.689  13.4807  4.59754  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -301.249  13.4807  4.59754  0.02805
protocols.relax.FastRelax: {0} CMD: min  -355.645  13.1485  4.69031  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -355.645  13.1485  4.69031  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.997  13.1485  4.69031  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2842 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.887  13.1485  4.69031  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.96  13.1485  4.69031  0.154
protocols.relax.FastRelax: {0} CMD: min  -280.126  12.5973  5.0461  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.126  12.5973  5.0461  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.599  12.5973  5.0461  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2696 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.25  12.5973  5.0461  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.691  12.5973  5.0461  0.31955
protocols.relax.FastRelax: {0} CMD: min  -249.732  12.5172  4.73076  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.732  12.5172  4.73076  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.484  12.5172  4.73076  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2646 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.455  12.5172  4.73076  0.55
protocols.relax.FastRelax: {0} CMD: min  -241.216  12.3124  5.72591  0.55
protocols.relax.FastRelax: {0} MRP: 1  -241.216  -241.216  12.3124  5.72591
protocols.relax.FastRelax: {0} CMD: accept_to_best  -241.216  12.3124  5.72591  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -241.216  12.3124  5.72591  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.216  12.3124  5.72591  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -308.278  12.3124  5.72591  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3163 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -325.458  12.3124  5.72591  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -321.652  12.3124  5.72591  0.02805
protocols.relax.FastRelax: {0} CMD: min  -377.866  12.4432  5.80413  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -377.866  12.4432  5.80413  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.321  12.4432  5.80413  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2964 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.463  12.4432  5.80413  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.316  12.4432  5.80413  0.154
protocols.relax.FastRelax: {0} CMD: min  -310.32  12.3414  5.71021  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -310.32  12.3414  5.71021  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.185  12.3414  5.71021  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2636 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -261.904  12.3414  5.71021  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.164  12.3414  5.71021  0.31955
protocols.relax.FastRelax: {0} CMD: min  -271.866  12.3714  5.70101  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.866  12.3714  5.70101  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.338  12.3714  5.70101  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2686 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.391  12.3714  5.70101  0.55
protocols.relax.FastRelax: {0} CMD: min  -253.411  12.3343  5.70735  0.55
protocols.relax.FastRelax: {0} MRP: 2  -253.411  -253.411  12.3343  5.70735
protocols.relax.FastRelax: {0} CMD: accept_to_best  -253.411  12.3343  5.70735  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -253.411  12.3343  5.70735  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.411  12.3343  5.70735  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -320.502  12.3343  5.70735  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3027 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -330.383  12.3343  5.70735  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -328.569  12.3343  5.70735  0.02805
protocols.relax.FastRelax: {0} CMD: min  -380.205  12.4069  5.82695  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -380.205  12.4069  5.82695  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.226  12.4069  5.82695  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3036 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.9  12.4069  5.82695  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.197  12.4069  5.82695  0.154
protocols.relax.FastRelax: {0} CMD: min  -315.637  12.3276  5.7056  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -315.637  12.3276  5.7056  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -268.296  12.3276  5.7056  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2862 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.611  12.3276  5.7056  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.946  12.3276  5.7056  0.31955
protocols.relax.FastRelax: {0} CMD: min  -276.65  12.3161  5.66531  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -276.65  12.3161  5.66531  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.478  12.3161  5.66531  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2682 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.74  12.3161  5.66531  0.55
protocols.relax.FastRelax: {0} CMD: min  -251.602  12.279  5.7755  0.55
protocols.relax.FastRelax: {0} MRP: 3  -251.602  -253.411  12.3343  5.70735
protocols.relax.FastRelax: {0} CMD: accept_to_best  -251.602  12.279  5.7755  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -251.602  12.279  5.7755  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.602  12.279  5.7755  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -320.083  12.279  5.7755  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2981 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -331.462  12.279  5.7755  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -329.525  12.279  5.7755  0.02805
protocols.relax.FastRelax: {0} CMD: min  -388.287  12.2921  5.72089  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -388.287  12.2921  5.72089  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.505  12.2921  5.72089  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3067 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.34  12.2921  5.72089  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.123  12.2921  5.72089  0.154
protocols.relax.FastRelax: {0} CMD: min  -312.875  12.3872  5.72061  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -312.875  12.3872  5.72061  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.215  12.3872  5.72061  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2906 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -263.355  12.3872  5.72061  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.384  12.3872  5.72061  0.31955
protocols.relax.FastRelax: {0} CMD: min  -275.834  12.417  5.70742  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.834  12.417  5.70742  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.372  12.417  5.70742  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2686 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.71  12.417  5.70742  0.55
protocols.relax.FastRelax: {0} CMD: min  -252.884  12.2319  5.85241  0.55
protocols.relax.FastRelax: {0} MRP: 4  -252.884  -253.411  12.3343  5.70735
protocols.relax.FastRelax: {0} CMD: accept_to_best  -252.884  12.2319  5.85241  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -252.884  12.2319  5.85241  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_31.pdb
protocols.relax.FastRelax: {0} CMD: repeat  65114.2  11.9018  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  65114.2  11.9018  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7591.46  11.9018  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2669 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  76.9024  11.9018  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  91.0026  11.9018  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -275.193  12.2471  3.06607  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.193  12.2471  3.06607  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -144.132  12.2471  3.06607  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3057 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.605  12.2471  3.06607  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.9  12.2471  3.06607  0.154
protocols.relax.FastRelax: {0} CMD: min  -220.489  12.3688  2.71744  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.489  12.3688  2.71744  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.286  12.3688  2.71744  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2690 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.888  12.3688  2.71744  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.627  12.3688  2.71744  0.31955
protocols.relax.FastRelax: {0} CMD: min  -191.868  12.4268  2.79246  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -191.868  12.4268  2.79246  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -152.542  12.4268  2.79246  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2511 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -148.872  12.4268  2.79246  0.55
protocols.relax.FastRelax: {0} CMD: min  -202.39  13.0426  3.41793  0.55
protocols.relax.FastRelax: {0} MRP: 0  -202.39  -202.39  13.0426  3.41793
protocols.relax.FastRelax: {0} CMD: accept_to_best  -202.39  13.0426  3.41793  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -202.39  13.0426  3.41793  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.39  13.0426  3.41793  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.27  13.0426  3.41793  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2654 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -270.694  13.0426  3.41793  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.519  13.0426  3.41793  0.02805
protocols.relax.FastRelax: {0} CMD: min  -312.255  13.0094  3.44512  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -312.255  13.0094  3.44512  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.829  13.0094  3.44512  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2703 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.203  13.0094  3.44512  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.344  13.0094  3.44512  0.154
protocols.relax.FastRelax: {0} CMD: min  -266.873  13.0378  3.34554  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -266.873  13.0378  3.34554  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.456  13.0378  3.34554  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2544 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.13  13.0378  3.34554  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.274  13.0378  3.34554  0.31955
protocols.relax.FastRelax: {0} CMD: min  -236.43  13.0723  3.42505  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.43  13.0723  3.42505  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.194  13.0723  3.42505  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2350 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.208  13.0723  3.42505  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.786  13.1686  3.64681  0.55
protocols.relax.FastRelax: {0} MRP: 1  -217.786  -217.786  13.1686  3.64681
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.786  13.1686  3.64681  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.786  13.1686  3.64681  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.786  13.1686  3.64681  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.493  13.1686  3.64681  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2499 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -277.598  13.1686  3.64681  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.281  13.1686  3.64681  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.518  12.9775  3.52219  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.518  12.9775  3.52219  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.335  12.9775  3.52219  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3095 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.02  12.9775  3.52219  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.78  12.9775  3.52219  0.154
protocols.relax.FastRelax: {0} CMD: min  -272.326  13.1907  3.68068  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -272.326  13.1907  3.68068  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.936  13.1907  3.68068  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2376 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.867  13.1907  3.68068  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.089  13.1907  3.68068  0.31955
protocols.relax.FastRelax: {0} CMD: min  -242.705  13.2113  3.66884  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.705  13.2113  3.66884  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.175  13.2113  3.66884  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2200 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -204.968  13.2113  3.66884  0.55
protocols.relax.FastRelax: {0} CMD: min  -223.913  13.215  3.77661  0.55
protocols.relax.FastRelax: {0} MRP: 2  -223.913  -223.913  13.215  3.77661
protocols.relax.FastRelax: {0} CMD: accept_to_best  -223.913  13.215  3.77661  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -223.913  13.215  3.77661  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.913  13.215  3.77661  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.641  13.215  3.77661  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2692 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.983  13.215  3.77661  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.551  13.215  3.77661  0.02805
protocols.relax.FastRelax: {0} CMD: min  -326.761  13.1173  3.65824  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -326.761  13.1173  3.65824  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.704  13.1173  3.65824  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2792 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.058  13.1173  3.65824  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.042  13.1173  3.65824  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.42  13.1853  3.75235  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.42  13.1853  3.75235  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.757  13.1853  3.75235  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2455 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.133  13.1853  3.75235  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.145  13.1853  3.75235  0.31955
protocols.relax.FastRelax: {0} CMD: min  -244.517  13.2314  3.80982  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.517  13.2314  3.80982  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.451  13.2314  3.80982  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2358 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.857  13.2314  3.80982  0.55
protocols.relax.FastRelax: {0} CMD: min  -224.994  13.1622  3.92309  0.55
protocols.relax.FastRelax: {0} MRP: 3  -224.994  -224.994  13.1622  3.92309
protocols.relax.FastRelax: {0} CMD: accept_to_best  -224.994  13.1622  3.92309  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -224.994  13.1622  3.92309  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.994  13.1622  3.92309  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.367  13.1622  3.92309  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2553 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -280.999  13.1622  3.92309  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.672  13.1622  3.92309  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.431  12.9707  3.79901  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.431  12.9707  3.79901  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.884  12.9707  3.79901  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2928 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.941  12.9707  3.79901  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.689  12.9707  3.79901  0.154
protocols.relax.FastRelax: {0} CMD: min  -270.275  13.0601  3.77929  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -270.275  13.0601  3.77929  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.941  13.0601  3.77929  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2506 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.51  13.0601  3.77929  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.427  13.0601  3.77929  0.31955
protocols.relax.FastRelax: {0} CMD: min  -245.774  13.0887  3.82604  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.774  13.0887  3.82604  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.745  13.0887  3.82604  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2331 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.898  13.0887  3.82604  0.55
protocols.relax.FastRelax: {0} CMD: min  -224.773  13.2323  4.07003  0.55
protocols.relax.FastRelax: {0} MRP: 4  -224.773  -224.994  13.1622  3.92309
protocols.relax.FastRelax: {0} CMD: accept_to_best  -224.773  13.2323  4.07003  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -224.773  13.2323  4.07003  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_24.pdb
protocols.relax.FastRelax: {0} CMD: repeat  73247.1  13.7156  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  73247.1  13.7156  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7672.54  13.7156  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2337 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  106.962  13.7156  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  124.973  13.7156  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -238.72  14.7289  4.84667  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.72  14.7289  4.84667  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -109.908  14.7289  4.84667  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2387 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -165.634  14.7289  4.84667  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160.213  14.7289  4.84667  0.154
protocols.relax.FastRelax: {0} CMD: min  -211.19  14.8561  5.17185  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.19  14.8561  5.17185  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.743  14.8561  5.17185  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2203 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.233  14.8561  5.17185  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.242  14.8561  5.17185  0.31955
protocols.relax.FastRelax: {0} CMD: min  -192.692  14.8535  5.48735  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -192.692  14.8535  5.48735  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -157.421  14.8535  5.48735  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2050 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -157.886  14.8535  5.48735  0.55
protocols.relax.FastRelax: {0} CMD: min  -211.02  14.9493  6.06273  0.55
protocols.relax.FastRelax: {0} MRP: 0  -211.02  -211.02  14.9493  6.06273
protocols.relax.FastRelax: {0} CMD: accept_to_best  -211.02  14.9493  6.06273  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -211.02  14.9493  6.06273  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.02  14.9493  6.06273  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.907  14.9493  6.06273  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2349 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -273.784  14.9493  6.06273  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.368  14.9493  6.06273  0.02805
protocols.relax.FastRelax: {0} CMD: min  -304.357  14.1242  5.05588  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -304.357  14.1242  5.05588  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.215  14.1242  5.05588  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2511 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.688  14.1242  5.05588  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.031  14.1242  5.05588  0.154
protocols.relax.FastRelax: {0} CMD: min  -263.865  14.1685  5.0148  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -263.865  14.1685  5.0148  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.178  14.1685  5.0148  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2516 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.197  14.1685  5.0148  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.793  14.1685  5.0148  0.31955
protocols.relax.FastRelax: {0} CMD: min  -234.555  14.1422  4.96451  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -234.555  14.1422  4.96451  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.255  14.1422  4.96451  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2376 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.216  14.1422  4.96451  0.55
protocols.relax.FastRelax: {0} CMD: min  -225.148  13.8071  4.65978  0.55
protocols.relax.FastRelax: {0} MRP: 1  -225.148  -225.148  13.8071  4.65978
protocols.relax.FastRelax: {0} CMD: accept_to_best  -225.148  13.8071  4.65978  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -225.148  13.8071  4.65978  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.148  13.8071  4.65978  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.504  13.8071  4.65978  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2189 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -280.222  13.8071  4.65978  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.911  13.8071  4.65978  0.02805
protocols.relax.FastRelax: {0} CMD: min  -306.754  14.1149  5.36212  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -306.754  14.1149  5.36212  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.491  14.1149  5.36212  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2694 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -246.2  14.1149  5.36212  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.402  14.1149  5.36212  0.154
protocols.relax.FastRelax: {0} CMD: min  -267.954  14.2146  5.65616  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.954  14.2146  5.65616  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.949  14.2146  5.65616  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2387 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.834  14.2146  5.65616  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.62  14.2146  5.65616  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.268  14.1393  5.48675  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.268  14.1393  5.48675  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.907  14.1393  5.48675  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2338 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.316  14.1393  5.48675  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.083  14.2574  5.92993  0.55
protocols.relax.FastRelax: {0} MRP: 2  -230.083  -230.083  14.2574  5.92993
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.083  14.2574  5.92993  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.083  14.2574  5.92993  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.083  14.2574  5.92993  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.987  14.2574  5.92993  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2321 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -286.416  14.2574  5.92993  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.058  14.2574  5.92993  0.02805
protocols.relax.FastRelax: {0} CMD: min  -311.315  14.4519  6.0796  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.315  14.4519  6.0796  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.417  14.4519  6.0796  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2479 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.131  14.4519  6.0796  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.55  14.4519  6.0796  0.154
protocols.relax.FastRelax: {0} CMD: min  -274.812  14.4073  6.07069  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.812  14.4073  6.07069  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.701  14.4073  6.07069  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2362 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -246.687  14.4073  6.07069  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.417  14.4073  6.07069  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.556  14.3948  6.03278  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.556  14.3948  6.03278  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.306  14.3948  6.03278  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2316 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.331  14.3948  6.03278  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.132  14.3895  6.12616  0.55
protocols.relax.FastRelax: {0} MRP: 3  -230.132  -230.132  14.3895  6.12616
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.132  14.3895  6.12616  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.132  14.3895  6.12616  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.132  14.3895  6.12616  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.723  14.3895  6.12616  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2368 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -287.689  14.3895  6.12616  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.318  14.3895  6.12616  0.02805
protocols.relax.FastRelax: {0} CMD: min  -316.292  14.5392  6.17991  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -316.292  14.5392  6.17991  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.789  14.5392  6.17991  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2697 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.199  14.5392  6.17991  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.076  14.5392  6.17991  0.154
protocols.relax.FastRelax: {0} CMD: min  -277.024  14.4762  6.1182  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.024  14.4762  6.1182  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.931  14.4762  6.1182  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2415 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.051  14.4762  6.1182  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.705  14.4762  6.1182  0.31955
protocols.relax.FastRelax: {0} CMD: min  -252.298  14.5048  6.203  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.298  14.5048  6.203  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.149  14.5048  6.203  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2287 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.518  14.5048  6.203  0.55
protocols.relax.FastRelax: {0} CMD: min  -231.777  14.4643  6.17276  0.55
protocols.relax.FastRelax: {0} MRP: 4  -231.777  -231.777  14.4643  6.17276
protocols.relax.FastRelax: {0} CMD: accept_to_best  -231.777  14.4643  6.17276  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -231.777  14.4643  6.17276  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_3.pdb
protocols.relax.FastRelax: {0} CMD: repeat  78054.8  17.8226  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  78054.8  17.8226  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7626.07  17.8226  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2505 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.7614  17.8226  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  3.60871  17.8226  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -255.89  19.5266  3.72977  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.89  19.5266  3.72977  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -108.716  19.5266  3.72977  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2389 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -140.577  19.5266  3.72977  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -133.716  19.5266  3.72977  0.154
protocols.relax.FastRelax: {0} CMD: min  -221.759  19.4491  4.7184  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.759  19.4491  4.7184  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.896  19.4491  4.7184  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2429 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.197  19.4491  4.7184  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.963  19.4491  4.7184  0.31955
protocols.relax.FastRelax: {0} CMD: min  -205.882  19.643  4.5127  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.882  19.643  4.5127  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.241  19.643  4.5127  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2326 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -168.673  19.643  4.5127  0.55
protocols.relax.FastRelax: {0} CMD: min  -205.598  19.6041  5.06488  0.55
protocols.relax.FastRelax: {0} MRP: 0  -205.598  -205.598  19.6041  5.06488
protocols.relax.FastRelax: {0} CMD: accept_to_best  -205.598  19.6041  5.06488  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -205.598  19.6041  5.06488  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.598  19.6041  5.06488  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.162  19.6041  5.06488  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2357 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.994  19.6041  5.06488  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.622  19.6041  5.06488  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.819  19.4215  5.70682  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.819  19.4215  5.70682  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.922  19.4215  5.70682  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2510 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.324  19.4215  5.70682  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.447  19.4215  5.70682  0.154
protocols.relax.FastRelax: {0} CMD: min  -255.074  19.5922  5.63023  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.074  19.5922  5.63023  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.823  19.5922  5.63023  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2430 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.859  19.5922  5.63023  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.692  19.5922  5.63023  0.31955
protocols.relax.FastRelax: {0} CMD: min  -223  19.6541  5.48717  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223  19.6541  5.48717  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.072  19.6541  5.48717  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2247 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.576  19.6541  5.48717  0.55
protocols.relax.FastRelax: {0} CMD: min  -210.165  19.6262  5.87107  0.55
protocols.relax.FastRelax: {0} MRP: 1  -210.165  -210.165  19.6262  5.87107
protocols.relax.FastRelax: {0} CMD: accept_to_best  -210.165  19.6262  5.87107  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -210.165  19.6262  5.87107  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.165  19.6262  5.87107  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.977  19.6262  5.87107  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2608 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -279.614  19.6262  5.87107  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.529  19.6262  5.87107  0.02805
protocols.relax.FastRelax: {0} CMD: min  -331.593  19.4194  5.85916  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -331.593  19.4194  5.85916  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.074  19.4194  5.85916  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2661 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.464  19.4194  5.85916  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.04  19.4194  5.85916  0.154
protocols.relax.FastRelax: {0} CMD: min  -264.237  19.5473  5.94463  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -264.237  19.5473  5.94463  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.653  19.5473  5.94463  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2468 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.745  19.5473  5.94463  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.567  19.5473  5.94463  0.31955
protocols.relax.FastRelax: {0} CMD: min  -230.722  19.6343  5.88081  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.722  19.6343  5.88081  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.367  19.6343  5.88081  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2327 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -190.434  19.6343  5.88081  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.641  19.6108  5.49959  0.55
protocols.relax.FastRelax: {0} MRP: 2  -217.641  -217.641  19.6108  5.49959
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.641  19.6108  5.49959  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.641  19.6108  5.49959  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.641  19.6108  5.49959  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.68  19.6108  5.49959  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2683 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -288.861  19.6108  5.49959  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.199  19.6108  5.49959  0.02805
protocols.relax.FastRelax: {0} CMD: min  -337.24  19.0605  5.76559  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -337.24  19.0605  5.76559  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.74  19.0605  5.76559  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2561 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.155  19.0605  5.76559  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.806  19.0605  5.76559  0.154
protocols.relax.FastRelax: {0} CMD: min  -273.802  19.352  5.5088  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.802  19.352  5.5088  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.123  19.352  5.5088  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2448 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.363  19.352  5.5088  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.151  19.352  5.5088  0.31955
protocols.relax.FastRelax: {0} CMD: min  -240.854  19.3536  5.62464  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -240.854  19.3536  5.62464  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.93  19.3536  5.62464  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2414 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.314  19.3536  5.62464  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.516  19.2688  5.7923  0.55
protocols.relax.FastRelax: {0} MRP: 3  -226.516  -226.516  19.2688  5.7923
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.516  19.2688  5.7923  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.516  19.2688  5.7923  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.516  19.2688  5.7923  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.287  19.2688  5.7923  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2687 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -292.936  19.2688  5.7923  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -290.839  19.2688  5.7923  0.02805
protocols.relax.FastRelax: {0} CMD: min  -354.299  18.794  6.22546  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -354.299  18.794  6.22546  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.411  18.794  6.22546  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2560 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.963  18.794  6.22546  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.552  18.794  6.22546  0.154
protocols.relax.FastRelax: {0} CMD: min  -289.343  18.9736  6.16387  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -289.343  18.9736  6.16387  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.302  18.9736  6.16387  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2449 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -245.275  18.9736  6.16387  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.814  18.9736  6.16387  0.31955
protocols.relax.FastRelax: {0} CMD: min  -252.009  19.0598  6.10467  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.009  19.0598  6.10467  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.326  19.0598  6.10467  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2405 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.637  19.0598  6.10467  0.55
protocols.relax.FastRelax: {0} CMD: min  -231.389  19.2123  5.86542  0.55
protocols.relax.FastRelax: {0} MRP: 4  -231.389  -231.389  19.2123  5.86542
protocols.relax.FastRelax: {0} CMD: accept_to_best  -231.389  19.2123  5.86542  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -231.389  19.2123  5.86542  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_23.pdb
protocols.relax.FastRelax: {0} CMD: repeat  77493.1  15.1411  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  77493.1  15.1411  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6707.43  15.1411  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2409 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -87.7666  15.1411  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.8871  15.1411  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -284.14  12.9035  4.89474  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.14  12.9035  4.89474  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -122.837  12.9035  4.89474  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2356 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -149.573  12.9035  4.89474  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -141.585  12.9035  4.89474  0.154
protocols.relax.FastRelax: {0} CMD: min  -214.832  12.5228  5.98936  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -214.832  12.5228  5.98936  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.891  12.5228  5.98936  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2313 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.48  12.5228  5.98936  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.997  12.5228  5.98936  0.31955
protocols.relax.FastRelax: {0} CMD: min  -196.233  12.6377  5.63582  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.233  12.6377  5.63582  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.664  12.6377  5.63582  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2214 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -154.503  12.6377  5.63582  0.55
protocols.relax.FastRelax: {0} CMD: min  -220.835  12.5915  6.16861  0.55
protocols.relax.FastRelax: {0} MRP: 0  -220.835  -220.835  12.5915  6.16861
protocols.relax.FastRelax: {0} CMD: accept_to_best  -220.835  12.5915  6.16861  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -220.835  12.5915  6.16861  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.835  12.5915  6.16861  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.005  12.5915  6.16861  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2553 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -294.317  12.5915  6.16861  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -290.663  12.5915  6.16861  0.02805
protocols.relax.FastRelax: {0} CMD: min  -330.941  12.8641  6.13673  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -330.941  12.8641  6.13673  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.851  12.8641  6.13673  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2691 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -244.498  12.8641  6.13673  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.257  12.8641  6.13673  0.154
protocols.relax.FastRelax: {0} CMD: min  -278.695  12.7013  6.29989  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -278.695  12.7013  6.29989  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.667  12.7013  6.29989  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2479 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.624  12.7013  6.29989  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.542  12.7013  6.29989  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.607  12.6135  6.40947  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.607  12.6135  6.40947  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.701  12.6135  6.40947  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2348 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.782  12.6135  6.40947  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.879  12.8349  6.46485  0.55
protocols.relax.FastRelax: {0} MRP: 1  -230.879  -230.879  12.8349  6.46485
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.879  12.8349  6.46485  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.879  12.8349  6.46485  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.879  12.8349  6.46485  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.418  12.8349  6.46485  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2547 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -301.833  12.8349  6.46485  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.836  12.8349  6.46485  0.02805
protocols.relax.FastRelax: {0} CMD: min  -337.728  12.7925  6.92415  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -337.728  12.7925  6.92415  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.285  12.7925  6.92415  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2589 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.555  12.7925  6.92415  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.052  12.7925  6.92415  0.154
protocols.relax.FastRelax: {0} CMD: min  -285.834  12.6928  6.84596  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -285.834  12.6928  6.84596  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.162  12.6928  6.84596  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2465 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.151  12.6928  6.84596  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.286  12.6928  6.84596  0.31955
protocols.relax.FastRelax: {0} CMD: min  -257.669  12.8286  6.62877  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.669  12.8286  6.62877  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.03  12.8286  6.62877  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2406 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.138  12.8286  6.62877  0.55
protocols.relax.FastRelax: {0} CMD: min  -239.142  13.136  6.36822  0.55
protocols.relax.FastRelax: {0} MRP: 2  -239.142  -239.142  13.136  6.36822
protocols.relax.FastRelax: {0} CMD: accept_to_best  -239.142  13.136  6.36822  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -239.142  13.136  6.36822  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.142  13.136  6.36822  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.761  13.136  6.36822  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2576 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -304.875  13.136  6.36822  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -302.912  13.136  6.36822  0.02805
protocols.relax.FastRelax: {0} CMD: min  -345.902  13.0781  6.5274  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -345.902  13.0781  6.5274  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.841  13.0781  6.5274  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2578 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -256.233  13.0781  6.5274  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.838  13.0781  6.5274  0.154
protocols.relax.FastRelax: {0} CMD: min  -290.605  13.0416  6.33096  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -290.605  13.0416  6.33096  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.975  13.0416  6.33096  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2473 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -255.338  13.0416  6.33096  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.456  13.0416  6.33096  0.31955
protocols.relax.FastRelax: {0} CMD: min  -262.051  13.1328  6.28374  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.051  13.1328  6.28374  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.6  13.1328  6.28374  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2435 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.713  13.1328  6.28374  0.55
protocols.relax.FastRelax: {0} CMD: min  -239.45  13.2429  6.23285  0.55
protocols.relax.FastRelax: {0} MRP: 3  -239.45  -239.45  13.2429  6.23285
protocols.relax.FastRelax: {0} CMD: accept_to_best  -239.45  13.2429  6.23285  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -239.45  13.2429  6.23285  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.45  13.2429  6.23285  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -295.28  13.2429  6.23285  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2562 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -305.538  13.2429  6.23285  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -303.113  13.2429  6.23285  0.02805
protocols.relax.FastRelax: {0} CMD: min  -342.691  13.1036  6.25923  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -342.691  13.1036  6.25923  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.772  13.1036  6.25923  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2588 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.839  13.1036  6.25923  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.453  13.1036  6.25923  0.154
protocols.relax.FastRelax: {0} CMD: min  -290.857  13.2008  6.25558  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -290.857  13.2008  6.25558  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.447  13.2008  6.25558  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2439 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.708  13.2008  6.25558  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.789  13.2008  6.25558  0.31955
protocols.relax.FastRelax: {0} CMD: min  -261.113  13.2469  6.23725  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.113  13.2469  6.23725  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.763  13.2469  6.23725  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2422 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.587  13.2469  6.23725  0.55
protocols.relax.FastRelax: {0} CMD: min  -239.552  13.3445  6.27443  0.55
protocols.relax.FastRelax: {0} MRP: 4  -239.552  -239.552  13.3445  6.27443
protocols.relax.FastRelax: {0} CMD: accept_to_best  -239.552  13.3445  6.27443  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -239.552  13.3445  6.27443  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_22.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70252.4  16.4903  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70252.4  16.4903  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7799.96  16.4903  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3197 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  174.345  16.4903  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  208.525  16.4903  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -258.24  16.7773  4.53765  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.24  16.7773  4.53765  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -76.2421  16.7773  4.53765  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2906 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -95.8438  16.7773  4.53765  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -84.7477  16.7773  4.53765  0.154
protocols.relax.FastRelax: {0} CMD: min  -185.784  16.8195  4.20675  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -185.784  16.8195  4.20675  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -128.059  16.8195  4.20675  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2516 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -132.092  16.8195  4.20675  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -127.584  16.8195  4.20675  0.31955
protocols.relax.FastRelax: {0} CMD: min  -157.037  17.0626  4.27444  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -157.037  17.0626  4.27444  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -106.669  17.0626  4.27444  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2399 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -106.394  17.0626  4.27444  0.55
core.optimization.LineMinimizer: {0} [ ERROR ] Inaccurate G! step= 4.76837e-07 Deriv= -0.333806 Finite Diff= 0.0287643
protocols.relax.FastRelax: {0} CMD: min  -167.849  16.6375  4.98094  0.55
protocols.relax.FastRelax: {0} MRP: 0  -167.849  -167.849  16.6375  4.98094
protocols.relax.FastRelax: {0} CMD: accept_to_best  -167.849  16.6375  4.98094  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -167.849  16.6375  4.98094  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -167.849  16.6375  4.98094  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.81  16.6375  4.98094  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2779 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.085  16.6375  4.98094  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.639  16.6375  4.98094  0.02805
protocols.relax.FastRelax: {0} CMD: min  -293.169  16.5049  4.79675  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -293.169  16.5049  4.79675  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.022  16.5049  4.79675  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2619 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.911  16.5049  4.79675  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.123  16.5049  4.79675  0.154
protocols.relax.FastRelax: {0} CMD: min  -244.68  16.6219  4.74119  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.68  16.6219  4.74119  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.683  16.6219  4.74119  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2576 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -202.127  16.6219  4.74119  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.802  16.6219  4.74119  0.31955
protocols.relax.FastRelax: {0} CMD: min  -208.53  16.4978  4.71013  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.53  16.4978  4.71013  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.298  16.4978  4.71013  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2458 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -163.616  16.4978  4.71013  0.55
protocols.relax.FastRelax: {0} CMD: min  -188.739  16.6433  4.61922  0.55
protocols.relax.FastRelax: {0} MRP: 1  -188.739  -188.739  16.6433  4.61922
protocols.relax.FastRelax: {0} CMD: accept_to_best  -188.739  16.6433  4.61922  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -188.739  16.6433  4.61922  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -188.739  16.6433  4.61922  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.534  16.6433  4.61922  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2725 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -271.09  16.6433  4.61922  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.317  16.6433  4.61922  0.02805
protocols.relax.FastRelax: {0} CMD: min  -308.774  16.295  4.97359  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -308.774  16.295  4.97359  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.638  16.295  4.97359  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2954 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.753  16.295  4.97359  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.461  16.295  4.97359  0.154
protocols.relax.FastRelax: {0} CMD: min  -253.836  16.4727  4.84766  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.836  16.4727  4.84766  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.343  16.4727  4.84766  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2549 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.377  16.4727  4.84766  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.107  16.4727  4.84766  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.678  16.4921  4.73465  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.678  16.4921  4.73465  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.684  16.4921  4.73465  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2428 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -176.784  16.4921  4.73465  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.707  16.6004  4.60075  0.55
protocols.relax.FastRelax: {0} MRP: 2  -194.707  -194.707  16.6004  4.60075
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.707  16.6004  4.60075  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.707  16.6004  4.60075  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.707  16.6004  4.60075  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.217  16.6004  4.60075  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2697 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -273.772  16.6004  4.60075  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.264  16.6004  4.60075  0.02805
protocols.relax.FastRelax: {0} CMD: min  -306.152  16.4815  4.95731  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -306.152  16.4815  4.95731  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.553  16.4815  4.95731  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2854 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.067  16.4815  4.95731  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.245  16.4815  4.95731  0.154
protocols.relax.FastRelax: {0} CMD: min  -250.867  16.3914  4.68501  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.867  16.3914  4.68501  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.643  16.3914  4.68501  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2483 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.043  16.3914  4.68501  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.849  16.3914  4.68501  0.31955
protocols.relax.FastRelax: {0} CMD: min  -218.441  16.4055  4.62323  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218.441  16.4055  4.62323  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.255  16.4055  4.62323  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2389 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.944  16.4055  4.62323  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.103  16.4876  4.75133  0.55
protocols.relax.FastRelax: {0} MRP: 3  -194.103  -194.707  16.6004  4.60075
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.103  16.4876  4.75133  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.103  16.4876  4.75133  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.103  16.4876  4.75133  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.941  16.4876  4.75133  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2574 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -273.307  16.4876  4.75133  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.373  16.4876  4.75133  0.02805
protocols.relax.FastRelax: {0} CMD: min  -309.879  15.9972  4.981  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -309.879  15.9972  4.981  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.155  15.9972  4.981  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2869 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.735  15.9972  4.981  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.799  15.9972  4.981  0.154
protocols.relax.FastRelax: {0} CMD: min  -255.52  16.238  4.78087  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.52  16.238  4.78087  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.943  16.238  4.78087  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2494 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.802  16.238  4.78087  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.617  16.238  4.78087  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.992  16.25  4.83535  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.992  16.25  4.83535  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.384  16.25  4.83535  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2393 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.016  16.25  4.83535  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.52  16.4689  4.78017  0.55
protocols.relax.FastRelax: {0} MRP: 4  -194.52  -194.707  16.6004  4.60075
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.52  16.4689  4.78017  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.52  16.4689  4.78017  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_37.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71876.7  14.2537  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71876.7  14.2537  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7365.59  14.2537  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2853 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  111.929  14.2537  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  135.363  14.2537  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -277.639  13.9405  2.59747  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.639  13.9405  2.59747  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -143.902  13.9405  2.59747  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2756 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -172.796  13.9405  2.59747  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.889  13.9405  2.59747  0.154
protocols.relax.FastRelax: {0} CMD: min  -222.819  13.955  3.05031  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.819  13.955  3.05031  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.587  13.955  3.05031  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2617 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -181.322  13.955  3.05031  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.081  13.955  3.05031  0.31955
protocols.relax.FastRelax: {0} CMD: min  -189.099  14.1057  3.02019  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -189.099  14.1057  3.02019  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -145.597  14.1057  3.02019  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2577 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -145.611  14.1057  3.02019  0.55
protocols.relax.FastRelax: {0} CMD: min  -193.21  13.6151  2.79788  0.55
protocols.relax.FastRelax: {0} MRP: 0  -193.21  -193.21  13.6151  2.79788
protocols.relax.FastRelax: {0} CMD: accept_to_best  -193.21  13.6151  2.79788  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -193.21  13.6151  2.79788  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.21  13.6151  2.79788  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.364  13.6151  2.79788  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2849 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -274.891  13.6151  2.79788  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.904  13.6151  2.79788  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.882  12.9211  3.18747  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.882  12.9211  3.18747  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.725  12.9211  3.18747  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2774 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.499  12.9211  3.18747  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.431  12.9211  3.18747  0.154
protocols.relax.FastRelax: {0} CMD: min  -261.343  13.152  2.9925  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.343  13.152  2.9925  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.497  13.152  2.9925  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2627 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.918  13.152  2.9925  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.434  13.152  2.9925  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.619  13.264  2.95607  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.619  13.264  2.95607  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.769  13.264  2.95607  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2554 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.296  13.264  2.95607  0.55
protocols.relax.FastRelax: {0} CMD: min  -211.979  13.214  3.29991  0.55
protocols.relax.FastRelax: {0} MRP: 1  -211.979  -211.979  13.214  3.29991
protocols.relax.FastRelax: {0} CMD: accept_to_best  -211.979  13.214  3.29991  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -211.979  13.214  3.29991  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.979  13.214  3.29991  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.781  13.214  3.29991  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2630 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -283.283  13.214  3.29991  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -282.027  13.214  3.29991  0.02805
protocols.relax.FastRelax: {0} CMD: min  -325.379  12.6591  3.74311  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -325.379  12.6591  3.74311  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.23  12.6591  3.74311  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2784 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.966  12.6591  3.74311  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.049  12.6591  3.74311  0.154
protocols.relax.FastRelax: {0} CMD: min  -271.937  12.7865  3.54533  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.937  12.7865  3.54533  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.328  12.7865  3.54533  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2488 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.934  12.7865  3.54533  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.63  12.7865  3.54533  0.31955
protocols.relax.FastRelax: {0} CMD: min  -238.427  12.983  3.37598  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.427  12.983  3.37598  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.044  12.983  3.37598  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2469 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.172  12.983  3.37598  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.928  13.1889  3.28378  0.55
protocols.relax.FastRelax: {0} MRP: 2  -212.928  -212.928  13.1889  3.28378
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.928  13.1889  3.28378  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.928  13.1889  3.28378  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.928  13.1889  3.28378  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.52  13.1889  3.28378  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2604 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -285.101  13.1889  3.28378  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.838  13.1889  3.28378  0.02805
protocols.relax.FastRelax: {0} CMD: min  -331.041  12.6156  3.96453  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -331.041  12.6156  3.96453  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.511  12.6156  3.96453  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2776 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.931  12.6156  3.96453  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.24  12.6156  3.96453  0.154
protocols.relax.FastRelax: {0} CMD: min  -273.864  12.8278  3.49093  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.864  12.8278  3.49093  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.358  12.8278  3.49093  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2482 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.696  12.8278  3.49093  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.442  12.8278  3.49093  0.31955
protocols.relax.FastRelax: {0} CMD: min  -235.911  12.7958  3.54494  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.911  12.7958  3.54494  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.071  12.7958  3.54494  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2463 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.49  12.7958  3.54494  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.928  13.173  3.29875  0.55
protocols.relax.FastRelax: {0} MRP: 3  -212.928  -212.928  13.173  3.29875
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.928  13.173  3.29875  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.928  13.173  3.29875  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.928  13.173  3.29875  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.733  13.173  3.29875  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2602 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -285.314  13.173  3.29875  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.063  13.173  3.29875  0.02805
protocols.relax.FastRelax: {0} CMD: min  -330.414  12.5727  3.95022  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -330.414  12.5727  3.95022  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.755  12.5727  3.95022  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2767 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.559  12.5727  3.95022  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.327  12.5727  3.95022  0.154
protocols.relax.FastRelax: {0} CMD: min  -271.669  13.0038  3.328  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.669  13.0038  3.328  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.303  13.0038  3.328  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2507 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.338  13.0038  3.328  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.958  13.0038  3.328  0.31955
protocols.relax.FastRelax: {0} CMD: min  -240.359  13.1239  3.2694  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -240.359  13.1239  3.2694  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.129  13.1239  3.2694  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2465 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.161  13.1239  3.2694  0.55
protocols.relax.FastRelax: {0} CMD: min  -213.02  13.0995  3.33368  0.55
protocols.relax.FastRelax: {0} MRP: 4  -213.02  -213.02  13.0995  3.33368
protocols.relax.FastRelax: {0} CMD: accept_to_best  -213.02  13.0995  3.33368  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -213.02  13.0995  3.33368  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_34.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71554.1  14.9587  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71554.1  14.9587  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6668.71  14.9587  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2833 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  140.496  14.9587  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  172.118  14.9587  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -144.052  12.2781  5.19559  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -144.052  12.2781  5.19559  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  343.462  12.2781  5.19559  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2737 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -128.486  12.2781  5.19559  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -121.309  12.2781  5.19559  0.154
protocols.relax.FastRelax: {0} CMD: min  -213.201  12.2105  5.17306  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.201  12.2105  5.17306  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.96  12.2105  5.17306  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2350 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -170.186  12.2105  5.17306  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.635  12.2105  5.17306  0.31955
protocols.relax.FastRelax: {0} CMD: min  -185.679  12.2414  5.17676  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -185.679  12.2414  5.17676  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -142.771  12.2414  5.17676  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2325 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -142.22  12.2414  5.17676  0.55
protocols.relax.FastRelax: {0} CMD: min  -180.831  12.2305  5.44466  0.55
protocols.relax.FastRelax: {0} MRP: 0  -180.831  -180.831  12.2305  5.44466
protocols.relax.FastRelax: {0} CMD: accept_to_best  -180.831  12.2305  5.44466  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -180.831  12.2305  5.44466  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -180.831  12.2305  5.44466  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.571  12.2305  5.44466  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2723 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.462  12.2305  5.44466  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.972  12.2305  5.44466  0.02805
protocols.relax.FastRelax: {0} CMD: min  -318.203  12.1788  5.58315  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -318.203  12.1788  5.58315  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.091  12.1788  5.58315  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3008 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.732  12.1788  5.58315  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.08  12.1788  5.58315  0.154
protocols.relax.FastRelax: {0} CMD: min  -247.845  12.2646  5.41198  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -247.845  12.2646  5.41198  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.092  12.2646  5.41198  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2930 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.115  12.2646  5.41198  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.612  12.2646  5.41198  0.31955
protocols.relax.FastRelax: {0} CMD: min  -206.935  12.2317  5.53443  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -206.935  12.2317  5.53443  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.937  12.2317  5.53443  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2522 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -158.783  12.2317  5.53443  0.55
protocols.relax.FastRelax: {0} CMD: min  -207.134  12.3861  5.46302  0.55
protocols.relax.FastRelax: {0} MRP: 1  -207.134  -207.134  12.3861  5.46302
protocols.relax.FastRelax: {0} CMD: accept_to_best  -207.134  12.3861  5.46302  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -207.134  12.3861  5.46302  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -207.134  12.3861  5.46302  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -272.22  12.3861  5.46302  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3002 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.374  12.3861  5.46302  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.229  12.3861  5.46302  0.02805
protocols.relax.FastRelax: {0} CMD: min  -335.834  12.2498  5.53999  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -335.834  12.2498  5.53999  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.939  12.2498  5.53999  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2975 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.108  12.2498  5.53999  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.978  12.2498  5.53999  0.154
protocols.relax.FastRelax: {0} CMD: min  -281.006  12.329  5.47305  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -281.006  12.329  5.47305  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.035  12.329  5.47305  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2875 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.602  12.329  5.47305  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.128  12.329  5.47305  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.58  12.3174  5.53895  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.58  12.3174  5.53895  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.001  12.3174  5.53895  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2664 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.662  12.3174  5.53895  0.55
protocols.relax.FastRelax: {0} CMD: min  -216.432  12.444  5.48002  0.55
protocols.relax.FastRelax: {0} MRP: 2  -216.432  -216.432  12.444  5.48002
protocols.relax.FastRelax: {0} CMD: accept_to_best  -216.432  12.444  5.48002  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -216.432  12.444  5.48002  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.432  12.444  5.48002  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.302  12.444  5.48002  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2857 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -290.715  12.444  5.48002  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.148  12.444  5.48002  0.02805
protocols.relax.FastRelax: {0} CMD: min  -329.284  12.4315  5.42089  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -329.284  12.4315  5.42089  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.512  12.4315  5.42089  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2890 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.912  12.4315  5.42089  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.314  12.4315  5.42089  0.154
protocols.relax.FastRelax: {0} CMD: min  -277.734  12.4054  5.50871  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.734  12.4054  5.50871  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.689  12.4054  5.50871  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2683 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.077  12.4054  5.50871  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.92  12.4054  5.50871  0.31955
protocols.relax.FastRelax: {0} CMD: min  -242.905  12.4002  5.54587  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.905  12.4002  5.54587  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.065  12.4002  5.54587  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2553 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.689  12.4002  5.54587  0.55
protocols.relax.FastRelax: {0} CMD: min  -219.668  12.5071  5.34339  0.55
protocols.relax.FastRelax: {0} MRP: 3  -219.668  -219.668  12.5071  5.34339
protocols.relax.FastRelax: {0} CMD: accept_to_best  -219.668  12.5071  5.34339  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -219.668  12.5071  5.34339  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -219.668  12.5071  5.34339  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.925  12.5071  5.34339  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3126 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -294.744  12.5071  5.34339  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -292.414  12.5071  5.34339  0.02805
protocols.relax.FastRelax: {0} CMD: min  -339.98  12.4101  5.4414  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -339.98  12.4101  5.4414  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.743  12.4101  5.4414  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2973 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.765  12.4101  5.4414  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.469  12.4101  5.4414  0.154
protocols.relax.FastRelax: {0} CMD: min  -283.312  12.4141  5.47075  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -283.312  12.4141  5.47075  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.724  12.4141  5.47075  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2783 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.591  12.4141  5.47075  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.092  12.4141  5.47075  0.31955
protocols.relax.FastRelax: {0} CMD: min  -243.133  12.4033  5.54644  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.133  12.4033  5.54644  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.224  12.4033  5.54644  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2584 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.498  12.4033  5.54644  0.55
protocols.relax.FastRelax: {0} CMD: min  -227.329  12.5147  5.38534  0.55
protocols.relax.FastRelax: {0} MRP: 4  -227.329  -227.329  12.5147  5.38534
protocols.relax.FastRelax: {0} CMD: accept_to_best  -227.329  12.5147  5.38534  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -227.329  12.5147  5.38534  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_45.pdb
protocols.relax.FastRelax: {0} CMD: repeat  75735.2  15.7869  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  75735.2  15.7869  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7625.09  15.7869  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3181 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.809  15.7869  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -157.352  15.7869  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -196.637  16.1173  2.60378  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.637  16.1173  2.60378  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  422.581  16.1173  2.60378  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3088 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -2.02449  16.1173  2.60378  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  16.5757  16.1173  2.60378  0.154
protocols.relax.FastRelax: {0} CMD: min  -261.783  15.8994  2.77216  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.783  15.8994  2.77216  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.284  15.8994  2.77216  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2985 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.387  15.8994  2.77216  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.411  15.8994  2.77216  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.361  15.893  2.62856  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.361  15.893  2.62856  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.36  15.893  2.62856  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2716 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.018  15.893  2.62856  0.55
protocols.relax.FastRelax: {0} CMD: min  -222.867  15.842  2.78978  0.55
protocols.relax.FastRelax: {0} MRP: 0  -222.867  -222.867  15.842  2.78978
protocols.relax.FastRelax: {0} CMD: accept_to_best  -222.867  15.842  2.78978  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -222.867  15.842  2.78978  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.867  15.842  2.78978  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.199  15.842  2.78978  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3145 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -309.033  15.842  2.78978  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -303.161  15.842  2.78978  0.02805
protocols.relax.FastRelax: {0} CMD: min  -383.965  15.9497  2.98523  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -383.965  15.9497  2.98523  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.619  15.9497  2.98523  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3247 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.68  15.9497  2.98523  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.83  15.9497  2.98523  0.154
protocols.relax.FastRelax: {0} CMD: min  -303.25  16.0072  3.03031  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -303.25  16.0072  3.03031  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.997  16.0072  3.03031  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2970 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.771  16.0072  3.03031  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.556  16.0072  3.03031  0.31955
protocols.relax.FastRelax: {0} CMD: min  -262.232  15.999  3.02275  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.232  15.999  3.02275  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.188  15.999  3.02275  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2776 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.299  15.999  3.02275  0.55
protocols.relax.FastRelax: {0} CMD: min  -244.163  16.0376  3.29744  0.55
protocols.relax.FastRelax: {0} MRP: 1  -244.163  -244.163  16.0376  3.29744
protocols.relax.FastRelax: {0} CMD: accept_to_best  -244.163  16.0376  3.29744  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -244.163  16.0376  3.29744  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.163  16.0376  3.29744  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -317.272  16.0376  3.29744  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3171 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -328.436  16.0376  3.29744  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -325.726  16.0376  3.29744  0.02805
protocols.relax.FastRelax: {0} CMD: min  -392.656  16.0566  3.4993  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -392.656  16.0566  3.4993  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.265  16.0566  3.4993  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3517 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.404  16.0566  3.4993  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.773  16.0566  3.4993  0.154
protocols.relax.FastRelax: {0} CMD: min  -308.684  16.1329  3.44948  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -308.684  16.1329  3.44948  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.26  16.1329  3.44948  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2897 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -258.015  16.1329  3.44948  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.911  16.1329  3.44948  0.31955
protocols.relax.FastRelax: {0} CMD: min  -270.629  16.1214  3.38364  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -270.629  16.1214  3.38364  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.064  16.1214  3.38364  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2786 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.297  16.1214  3.38364  0.55
protocols.relax.FastRelax: {0} CMD: min  -243.275  15.985  3.48663  0.55
protocols.relax.FastRelax: {0} MRP: 2  -243.275  -244.163  16.0376  3.29744
protocols.relax.FastRelax: {0} CMD: accept_to_best  -243.275  15.985  3.48663  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -243.275  15.985  3.48663  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.275  15.985  3.48663  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -315.287  15.985  3.48663  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3063 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -326.289  15.985  3.48663  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -323.895  15.985  3.48663  0.02805
protocols.relax.FastRelax: {0} CMD: min  -388.264  16.0195  3.65915  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -388.264  16.0195  3.65915  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.602  16.0195  3.65915  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3218 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.415  16.0195  3.65915  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.627  16.0195  3.65915  0.154
protocols.relax.FastRelax: {0} CMD: min  -310.67  16.067  3.67201  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -310.67  16.067  3.67201  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.689  16.067  3.67201  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2820 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.532  16.067  3.67201  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.549  16.067  3.67201  0.31955
protocols.relax.FastRelax: {0} CMD: min  -274.52  16.0978  3.65588  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.52  16.0978  3.65588  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.011  16.0978  3.65588  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2797 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.609  16.0978  3.65588  0.55
protocols.relax.FastRelax: {0} CMD: min  -247.19  16.1224  3.5803  0.55
protocols.relax.FastRelax: {0} MRP: 3  -247.19  -247.19  16.1224  3.5803
protocols.relax.FastRelax: {0} CMD: accept_to_best  -247.19  16.1224  3.5803  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -247.19  16.1224  3.5803  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -247.19  16.1224  3.5803  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -319.044  16.1224  3.5803  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3152 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -332.694  16.1224  3.5803  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -329.543  16.1224  3.5803  0.02805
protocols.relax.FastRelax: {0} CMD: min  -405.123  16.1568  3.77724  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -405.123  16.1568  3.77724  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.177  16.1568  3.77724  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3154 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.537  16.1568  3.77724  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.507  16.1568  3.77724  0.154
protocols.relax.FastRelax: {0} CMD: min  -318.983  16.2001  3.69344  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -318.983  16.2001  3.69344  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.342  16.2001  3.69344  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2860 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -265.701  16.2001  3.69344  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.264  16.2001  3.69344  0.31955
protocols.relax.FastRelax: {0} CMD: min  -280.875  16.2239  3.66667  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.875  16.2239  3.66667  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.896  16.2239  3.66667  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2781 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.935  16.2239  3.66667  0.55
protocols.relax.FastRelax: {0} CMD: min  -251.015  16.1517  3.62796  0.55
protocols.relax.FastRelax: {0} MRP: 4  -251.015  -251.015  16.1517  3.62796
protocols.relax.FastRelax: {0} CMD: accept_to_best  -251.015  16.1517  3.62796  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -251.015  16.1517  3.62796  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_12.pdb
protocols.relax.FastRelax: {0} CMD: repeat  69904.2  17.6352  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  69904.2  17.6352  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7025.06  17.6352  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2904 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -89.6489  17.6352  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -59.639  17.6352  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -229.92  17.3113  2.35941  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.92  17.3113  2.35941  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1.56691  17.3113  2.35941  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2828 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -23.9116  17.3113  2.35941  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.14441  17.3113  2.35941  0.154
protocols.relax.FastRelax: {0} CMD: min  -200.375  17.3873  2.54943  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.375  17.3873  2.54943  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -152.222  17.3873  2.54943  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2623 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -153.429  17.3873  2.54943  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -149.719  17.3873  2.54943  0.31955
protocols.relax.FastRelax: {0} CMD: min  -182.177  17.3245  2.90234  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -182.177  17.3245  2.90234  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.11  17.3245  2.90234  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2372 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -140.71  17.3245  2.90234  0.55
protocols.relax.FastRelax: {0} CMD: min  -177.306  17.3652  3.3477  0.55
protocols.relax.FastRelax: {0} MRP: 0  -177.306  -177.306  17.3652  3.3477
protocols.relax.FastRelax: {0} CMD: accept_to_best  -177.306  17.3652  3.3477  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -177.306  17.3652  3.3477  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -177.306  17.3652  3.3477  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.934  17.3652  3.3477  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2946 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -262.278  17.3652  3.3477  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.772  17.3652  3.3477  0.02805
protocols.relax.FastRelax: {0} CMD: min  -311.949  17.2226  3.42948  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.949  17.2226  3.42948  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.75  17.2226  3.42948  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2899 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -188.18  17.2226  3.42948  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.212  17.2226  3.42948  0.154
protocols.relax.FastRelax: {0} CMD: min  -254.141  17.3018  3.40295  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.141  17.3018  3.40295  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.966  17.3018  3.40295  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2619 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.076  17.3018  3.40295  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.52  17.3018  3.40295  0.31955
protocols.relax.FastRelax: {0} CMD: min  -215.227  17.3694  3.40792  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.227  17.3694  3.40792  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.892  17.3694  3.40792  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2313 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -169.022  17.3694  3.40792  0.55
protocols.relax.FastRelax: {0} CMD: min  -189.79  17.3789  3.33618  0.55
protocols.relax.FastRelax: {0} MRP: 1  -189.79  -189.79  17.3789  3.33618
protocols.relax.FastRelax: {0} CMD: accept_to_best  -189.79  17.3789  3.33618  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -189.79  17.3789  3.33618  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -189.79  17.3789  3.33618  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.829  17.3789  3.33618  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2803 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.28  17.3789  3.33618  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.452  17.3789  3.33618  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.266  17.1918  3.39719  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.266  17.1918  3.39719  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.876  17.1918  3.39719  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2857 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.882  17.1918  3.39719  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.191  17.1918  3.39719  0.154
protocols.relax.FastRelax: {0} CMD: min  -254.993  17.3207  3.40282  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.993  17.3207  3.40282  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.251  17.3207  3.40282  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2557 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.464  17.3207  3.40282  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.814  17.3207  3.40282  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.844  17.3868  3.39752  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.844  17.3868  3.39752  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.577  17.3868  3.39752  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2327 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -173.628  17.3868  3.39752  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.486  17.4053  3.70403  0.55
protocols.relax.FastRelax: {0} MRP: 2  -194.486  -194.486  17.4053  3.70403
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.486  17.4053  3.70403  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.486  17.4053  3.70403  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.486  17.4053  3.70403  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.939  17.4053  3.70403  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2734 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -277.958  17.4053  3.70403  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.284  17.4053  3.70403  0.02805
protocols.relax.FastRelax: {0} CMD: min  -326.932  17.2305  3.60428  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -326.932  17.2305  3.60428  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.065  17.2305  3.60428  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2887 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.059  17.2305  3.60428  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.934  17.2305  3.60428  0.154
protocols.relax.FastRelax: {0} CMD: min  -261.744  17.3034  3.61641  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.744  17.3034  3.61641  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.318  17.3034  3.61641  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2544 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.522  17.3034  3.61641  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.811  17.3034  3.61641  0.31955
protocols.relax.FastRelax: {0} CMD: min  -223.373  17.3711  3.66642  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.373  17.3711  3.66642  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.947  17.3711  3.66642  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2267 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -177.947  17.3711  3.66642  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.482  17.4089  3.74675  0.55
protocols.relax.FastRelax: {0} MRP: 3  -194.482  -194.486  17.4053  3.70403
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.482  17.4089  3.74675  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.482  17.4089  3.74675  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.482  17.4089  3.74675  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.347  17.4089  3.74675  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2747 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -276.76  17.4089  3.74675  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.194  17.4089  3.74675  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.986  17.1894  3.64778  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.986  17.1894  3.64778  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.219  17.1894  3.64778  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2912 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.796  17.1894  3.64778  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.559  17.1894  3.64778  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.17  17.3012  3.63743  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.17  17.3012  3.63743  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.039  17.3012  3.63743  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2472 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.748  17.3012  3.63743  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.038  17.3012  3.63743  0.31955
protocols.relax.FastRelax: {0} CMD: min  -223.559  17.3579  3.68102  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.559  17.3579  3.68102  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.677  17.3579  3.68102  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2296 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.708  17.3579  3.68102  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.486  17.41  3.7498  0.55
protocols.relax.FastRelax: {0} MRP: 4  -194.486  -194.486  17.41  3.7498
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.486  17.41  3.7498  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.486  17.41  3.7498  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_16.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71688.3  15.1177  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71688.3  15.1177  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6983.26  15.1177  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2275 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  74.3817  15.1177  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  99.7462  15.1177  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -235.568  16.449  6.98723  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.568  16.449  6.98723  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -43.3533  16.449  6.98723  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2144 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -96.8451  16.449  6.98723  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -87.7174  16.449  6.98723  0.154
protocols.relax.FastRelax: {0} CMD: min  -212.887  16.4897  6.77264  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.887  16.4897  6.77264  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.069  16.4897  6.77264  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2072 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.45  16.4897  6.77264  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.288  16.4897  6.77264  0.31955
protocols.relax.FastRelax: {0} CMD: min  -183.114  16.6021  6.33504  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -183.114  16.6021  6.33504  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.383  16.6021  6.33504  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2013 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -137.667  16.6021  6.33504  0.55
protocols.relax.FastRelax: {0} CMD: min  -190.633  16.7017  6.92757  0.55
protocols.relax.FastRelax: {0} MRP: 0  -190.633  -190.633  16.7017  6.92757
protocols.relax.FastRelax: {0} CMD: accept_to_best  -190.633  16.7017  6.92757  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -190.633  16.7017  6.92757  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -190.633  16.7017  6.92757  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.32  16.7017  6.92757  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2293 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.295  16.7017  6.92757  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -268.732  16.7017  6.92757  0.02805
protocols.relax.FastRelax: {0} CMD: min  -307.439  17.3689  8.67753  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -307.439  17.3689  8.67753  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -101.969  17.3689  8.67753  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2931 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.523  17.3689  8.67753  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.861  17.3689  8.67753  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.355  17.4065  8.75876  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.355  17.4065  8.75876  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.56  17.4065  8.75876  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2609 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.872  17.4065  8.75876  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.441  17.4065  8.75876  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.844  17.4579  8.75625  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.844  17.4579  8.75625  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.51  17.4579  8.75625  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2451 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -173.349  17.4579  8.75625  0.55
protocols.relax.FastRelax: {0} CMD: min  -210.842  17.5118  8.80012  0.55
protocols.relax.FastRelax: {0} MRP: 1  -210.842  -210.842  17.5118  8.80012
protocols.relax.FastRelax: {0} CMD: accept_to_best  -210.842  17.5118  8.80012  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -210.842  17.5118  8.80012  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.842  17.5118  8.80012  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.054  17.5118  8.80012  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2976 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -298.819  17.5118  8.80012  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -295.176  17.5118  8.80012  0.02805
protocols.relax.FastRelax: {0} CMD: min  -335.723  17.3075  8.84863  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -335.723  17.3075  8.84863  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.629  17.3075  8.84863  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2914 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.949  17.3075  8.84863  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.402  17.3075  8.84863  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.696  17.3277  8.85441  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.696  17.3277  8.85441  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.499  17.3277  8.85441  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2707 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.359  17.3277  8.85441  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.848  17.3277  8.85441  0.31955
protocols.relax.FastRelax: {0} CMD: min  -242.852  17.4034  8.82422  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.852  17.4034  8.82422  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.385  17.4034  8.82422  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2670 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.997  17.4034  8.82422  0.55
protocols.relax.FastRelax: {0} CMD: min  -219.67  17.5226  8.83919  0.55
protocols.relax.FastRelax: {0} MRP: 2  -219.67  -219.67  17.5226  8.83919
protocols.relax.FastRelax: {0} CMD: accept_to_best  -219.67  17.5226  8.83919  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -219.67  17.5226  8.83919  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -219.67  17.5226  8.83919  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.438  17.5226  8.83919  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3061 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -305.672  17.5226  8.83919  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -301.993  17.5226  8.83919  0.02805
protocols.relax.FastRelax: {0} CMD: min  -353.369  17.3559  8.89995  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -353.369  17.3559  8.89995  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.746  17.3559  8.89995  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2949 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.481  17.3559  8.89995  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.338  17.3559  8.89995  0.154
protocols.relax.FastRelax: {0} CMD: min  -284.402  17.4165  8.86842  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.402  17.4165  8.86842  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.7  17.4165  8.86842  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2715 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.69  17.4165  8.86842  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.269  17.4165  8.86842  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.052  17.4524  8.83914  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.052  17.4524  8.83914  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.039  17.4524  8.83914  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2610 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.27  17.4524  8.83914  0.55
protocols.relax.FastRelax: {0} CMD: min  -224.908  17.4673  8.81043  0.55
protocols.relax.FastRelax: {0} MRP: 3  -224.908  -224.908  17.4673  8.81043
protocols.relax.FastRelax: {0} CMD: accept_to_best  -224.908  17.4673  8.81043  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -224.908  17.4673  8.81043  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.908  17.4673  8.81043  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.18  17.4673  8.81043  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3062 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -309.26  17.4673  8.81043  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -305.409  17.4673  8.81043  0.02805
protocols.relax.FastRelax: {0} CMD: min  -351.087  17.1435  8.81287  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -351.087  17.1435  8.81287  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.895  17.1435  8.81287  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2912 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.745  17.1435  8.81287  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.331  17.1435  8.81287  0.154
protocols.relax.FastRelax: {0} CMD: min  -287.837  17.3332  8.85458  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -287.837  17.3332  8.85458  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.596  17.3332  8.85458  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2682 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.951  17.3332  8.85458  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.284  17.3332  8.85458  0.31955
protocols.relax.FastRelax: {0} CMD: min  -255.759  17.3782  8.83483  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.759  17.3782  8.83483  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.041  17.3782  8.83483  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2640 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.033  17.3782  8.83483  0.55
protocols.relax.FastRelax: {0} CMD: min  -233.859  17.4051  8.83466  0.55
protocols.relax.FastRelax: {0} MRP: 4  -233.859  -233.859  17.4051  8.83466
protocols.relax.FastRelax: {0} CMD: accept_to_best  -233.859  17.4051  8.83466  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -233.859  17.4051  8.83466  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_20.pdb
protocols.relax.FastRelax: {0} CMD: repeat  67375.4  12.2526  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  67375.4  12.2526  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7174.78  12.2526  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3021 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -33.1995  12.2526  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6.03454  12.2526  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -254.196  14.6703  4.66754  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.196  14.6703  4.66754  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -116.672  14.6703  4.66754  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2792 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -138.631  14.6703  4.66754  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -131.469  14.6703  4.66754  0.154
protocols.relax.FastRelax: {0} CMD: min  -222.118  14.5061  4.42646  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.118  14.5061  4.42646  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.926  14.5061  4.42646  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2493 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.532  14.5061  4.42646  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.095  14.5061  4.42646  0.31955
protocols.relax.FastRelax: {0} CMD: min  -191.329  14.5354  4.4856  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -191.329  14.5354  4.4856  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -149.054  14.5354  4.4856  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2319 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -149.428  14.5354  4.4856  0.55
protocols.relax.FastRelax: {0} CMD: min  -190.114  14.8141  5.06949  0.55
protocols.relax.FastRelax: {0} MRP: 0  -190.114  -190.114  14.8141  5.06949
protocols.relax.FastRelax: {0} CMD: accept_to_best  -190.114  14.8141  5.06949  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -190.114  14.8141  5.06949  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -190.114  14.8141  5.06949  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.813  14.8141  5.06949  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2786 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -268.38  14.8141  5.06949  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.768  14.8141  5.06949  0.02805
protocols.relax.FastRelax: {0} CMD: min  -315.605  14.8772  5.36871  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -315.605  14.8772  5.36871  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.828  14.8772  5.36871  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2856 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.544  14.8772  5.36871  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.689  14.8772  5.36871  0.154
protocols.relax.FastRelax: {0} CMD: min  -253.268  14.8755  5.34945  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.268  14.8755  5.34945  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.571  14.8755  5.34945  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2505 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.492  14.8755  5.34945  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.015  14.8755  5.34945  0.31955
protocols.relax.FastRelax: {0} CMD: min  -218.773  14.8017  5.26429  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218.773  14.8017  5.26429  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.115  14.8017  5.26429  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2473 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -177.27  14.8017  5.26429  0.55
protocols.relax.FastRelax: {0} CMD: min  -200.045  14.6953  5.27357  0.55
protocols.relax.FastRelax: {0} MRP: 1  -200.045  -200.045  14.6953  5.27357
protocols.relax.FastRelax: {0} CMD: accept_to_best  -200.045  14.6953  5.27357  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -200.045  14.6953  5.27357  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.045  14.6953  5.27357  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.16  14.6953  5.27357  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2777 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -274.765  14.6953  5.27357  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.598  14.6953  5.27357  0.02805
protocols.relax.FastRelax: {0} CMD: min  -319.162  14.8652  5.54  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -319.162  14.8652  5.54  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.07  14.8652  5.54  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2947 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.002  14.8652  5.54  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.73  14.8652  5.54  0.154
protocols.relax.FastRelax: {0} CMD: min  -260.704  14.8314  5.41055  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.704  14.8314  5.41055  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.804  14.8314  5.41055  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2520 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.631  14.8314  5.41055  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.389  14.8314  5.41055  0.31955
protocols.relax.FastRelax: {0} CMD: min  -225.648  14.7976  5.42645  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.648  14.7976  5.42645  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.77  14.7976  5.42645  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2426 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -182.919  14.7976  5.42645  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.586  14.7779  5.33013  0.55
protocols.relax.FastRelax: {0} MRP: 2  -201.586  -201.586  14.7779  5.33013
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.586  14.7779  5.33013  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.586  14.7779  5.33013  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -201.586  14.7779  5.33013  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.441  14.7779  5.33013  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2870 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -282.145  14.7779  5.33013  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.053  14.7779  5.33013  0.02805
protocols.relax.FastRelax: {0} CMD: min  -325.808  14.9972  5.63942  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -325.808  14.9972  5.63942  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.272  14.9972  5.63942  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3056 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.989  14.9972  5.63942  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.742  14.9972  5.63942  0.154
protocols.relax.FastRelax: {0} CMD: min  -262.826  15.0437  5.64171  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.826  15.0437  5.64171  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.429  15.0437  5.64171  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2754 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.427  15.0437  5.64171  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.116  15.0437  5.64171  0.31955
protocols.relax.FastRelax: {0} CMD: min  -225.372  15.0573  5.69678  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.372  15.0573  5.69678  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.839  15.0573  5.69678  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2408 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -181.191  15.0573  5.69678  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.56  15.0692  5.65044  0.55
protocols.relax.FastRelax: {0} MRP: 3  -201.56  -201.586  14.7779  5.33013
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.56  15.0692  5.65044  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.56  15.0692  5.65044  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -201.56  15.0692  5.65044  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -268.083  15.0692  5.65044  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2917 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.775  15.0692  5.65044  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.701  15.0692  5.65044  0.02805
protocols.relax.FastRelax: {0} CMD: min  -335.247  14.9346  5.70535  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -335.247  14.9346  5.70535  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.134  14.9346  5.70535  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2900 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.442  14.9346  5.70535  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.838  14.9346  5.70535  0.154
protocols.relax.FastRelax: {0} CMD: min  -270.304  14.9867  5.65952  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -270.304  14.9867  5.65952  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.112  14.9867  5.65952  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2746 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.415  14.9867  5.65952  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.831  14.9867  5.65952  0.31955
protocols.relax.FastRelax: {0} CMD: min  -228.649  14.9645  5.62519  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.649  14.9645  5.62519  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.172  14.9645  5.62519  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2580 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.438  14.9645  5.62519  0.55
protocols.relax.FastRelax: {0} CMD: min  -206.977  14.9483  5.60721  0.55
protocols.relax.FastRelax: {0} MRP: 4  -206.977  -206.977  14.9483  5.60721
protocols.relax.FastRelax: {0} CMD: accept_to_best  -206.977  14.9483  5.60721  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -206.977  14.9483  5.60721  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_5.pdb
protocols.relax.FastRelax: {0} CMD: repeat  72821.8  17.8027  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  72821.8  17.8027  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6741.94  17.8027  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2971 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -28.2696  17.8027  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  24.2683  17.8027  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -294.256  17.1717  2.74825  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -294.256  17.1717  2.74825  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -118.016  17.1717  2.74825  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2654 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -143.225  17.1717  2.74825  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -134.084  17.1717  2.74825  0.154
protocols.relax.FastRelax: {0} CMD: min  -244.123  16.9575  4.00747  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.123  16.9575  4.00747  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.186  16.9575  4.00747  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2645 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.54  16.9575  4.00747  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.649  16.9575  4.00747  0.31955
protocols.relax.FastRelax: {0} CMD: min  -202.341  16.9641  4.02532  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.341  16.9641  4.02532  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -151.808  16.9641  4.02532  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2626 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -152.385  16.9641  4.02532  0.55
protocols.relax.FastRelax: {0} CMD: min  -202.786  16.9842  5.88711  0.55
protocols.relax.FastRelax: {0} MRP: 0  -202.786  -202.786  16.9842  5.88711
protocols.relax.FastRelax: {0} CMD: accept_to_best  -202.786  16.9842  5.88711  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -202.786  16.9842  5.88711  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.786  16.9842  5.88711  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.476  16.9842  5.88711  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3003 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -288.931  16.9842  5.88711  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.262  16.9842  5.88711  0.02805
protocols.relax.FastRelax: {0} CMD: min  -360.317  16.952  5.9637  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -360.317  16.952  5.9637  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.067  16.952  5.9637  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3096 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.825  16.952  5.9637  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.328  16.952  5.9637  0.154
protocols.relax.FastRelax: {0} CMD: min  -284.848  17.0012  6.05841  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.848  17.0012  6.05841  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.858  17.0012  6.05841  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2723 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.691  17.0012  6.05841  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.601  17.0012  6.05841  0.31955
protocols.relax.FastRelax: {0} CMD: min  -244.553  17.0432  6.18589  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.553  17.0432  6.18589  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.351  17.0432  6.18589  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2666 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -193.615  17.0432  6.18589  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.836  17.0987  6.35612  0.55
protocols.relax.FastRelax: {0} MRP: 1  -226.836  -226.836  17.0987  6.35612
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.836  17.0987  6.35612  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.836  17.0987  6.35612  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.836  17.0987  6.35612  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.629  17.0987  6.35612  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2992 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -306.692  17.0987  6.35612  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -304.174  17.0987  6.35612  0.02805
protocols.relax.FastRelax: {0} CMD: min  -354.837  16.9966  6.21062  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -354.837  16.9966  6.21062  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.395  16.9966  6.21062  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3078 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.633  16.9966  6.21062  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.958  16.9966  6.21062  0.154
protocols.relax.FastRelax: {0} CMD: min  -290.568  17.0574  6.24521  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -290.568  17.0574  6.24521  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.803  17.0574  6.24521  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2907 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -245.276  17.0574  6.24521  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.645  17.0574  6.24521  0.31955
protocols.relax.FastRelax: {0} CMD: min  -254.483  17.0974  6.34274  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.483  17.0974  6.34274  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.83  17.0974  6.34274  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2798 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.149  17.0974  6.34274  0.55
protocols.relax.FastRelax: {0} CMD: min  -228.735  17.1374  6.33303  0.55
protocols.relax.FastRelax: {0} MRP: 2  -228.735  -228.735  17.1374  6.33303
protocols.relax.FastRelax: {0} CMD: accept_to_best  -228.735  17.1374  6.33303  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -228.735  17.1374  6.33303  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.735  17.1374  6.33303  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -296.321  17.1374  6.33303  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2926 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -307.865  17.1374  6.33303  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -304.992  17.1374  6.33303  0.02805
protocols.relax.FastRelax: {0} CMD: min  -373.191  16.9706  6.04943  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -373.191  16.9706  6.04943  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.687  16.9706  6.04943  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3160 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.299  16.9706  6.04943  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.808  16.9706  6.04943  0.154
protocols.relax.FastRelax: {0} CMD: min  -301.285  17.0357  6.18269  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -301.285  17.0357  6.18269  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.381  17.0357  6.18269  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2833 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -252.763  17.0357  6.18269  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.945  17.0357  6.18269  0.31955
protocols.relax.FastRelax: {0} CMD: min  -260.932  17.0686  6.27928  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.932  17.0686  6.27928  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.374  17.0686  6.27928  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2751 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.684  17.0686  6.27928  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.642  17.1035  6.32146  0.55
protocols.relax.FastRelax: {0} MRP: 3  -230.642  -230.642  17.1035  6.32146
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.642  17.1035  6.32146  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.642  17.1035  6.32146  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.642  17.1035  6.32146  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.504  17.1035  6.32146  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3051 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -308.609  17.1035  6.32146  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -306.382  17.1035  6.32146  0.02805
protocols.relax.FastRelax: {0} CMD: min  -374.699  17.0024  6.20581  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -374.699  17.0024  6.20581  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.479  17.0024  6.20581  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3423 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.261  17.0024  6.20581  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.234  17.0024  6.20581  0.154
protocols.relax.FastRelax: {0} CMD: min  -302.771  17.0632  6.6087  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -302.771  17.0632  6.6087  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.974  17.0632  6.6087  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2940 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -253.378  17.0632  6.6087  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.496  17.0632  6.6087  0.31955
protocols.relax.FastRelax: {0} CMD: min  -260.622  17.0963  6.72003  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.622  17.0963  6.72003  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.517  17.0963  6.72003  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2766 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.809  17.0963  6.72003  0.55
protocols.relax.FastRelax: {0} CMD: min  -231.491  17.1418  7.08443  0.55
protocols.relax.FastRelax: {0} MRP: 4  -231.491  -231.491  17.1418  7.08443
protocols.relax.FastRelax: {0} CMD: accept_to_best  -231.491  17.1418  7.08443  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -231.491  17.1418  7.08443  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_47.pdb
protocols.relax.FastRelax: {0} CMD: repeat  73552.1  15.1452  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  73552.1  15.1452  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7208.47  15.1452  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2965 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -34.349  15.1452  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  17.388  15.1452  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -282.061  15.2405  3.03796  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.061  15.2405  3.03796  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -88.5396  15.2405  3.03796  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3098 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -116.833  15.2405  3.03796  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -107.18  15.2405  3.03796  0.154
protocols.relax.FastRelax: {0} CMD: min  -229.843  15.3041  3.45941  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.843  15.3041  3.45941  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.812  15.3041  3.45941  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2853 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.685  15.3041  3.45941  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.234  15.3041  3.45941  0.31955
protocols.relax.FastRelax: {0} CMD: min  -207.564  15.3486  3.75621  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -207.564  15.3486  3.75621  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -165.992  15.3486  3.75621  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2768 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -166.462  15.3486  3.75621  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.282  15.3202  4.23867  0.55
protocols.relax.FastRelax: {0} MRP: 0  -217.282  -217.282  15.3202  4.23867
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.282  15.3202  4.23867  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.282  15.3202  4.23867  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.282  15.3202  4.23867  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.198  15.3202  4.23867  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3253 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -301.441  15.3202  4.23867  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.977  15.3202  4.23867  0.02805
protocols.relax.FastRelax: {0} CMD: min  -365.45  15.1482  3.90421  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -365.45  15.1482  3.90421  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.144  15.1482  3.90421  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2948 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.227  15.1482  3.90421  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.049  15.1482  3.90421  0.154
protocols.relax.FastRelax: {0} CMD: min  -289.065  15.2636  3.9404  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -289.065  15.2636  3.9404  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.945  15.2636  3.9404  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2859 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.027  15.2636  3.9404  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.132  15.2636  3.9404  0.31955
protocols.relax.FastRelax: {0} CMD: min  -261.861  15.2646  3.98055  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.861  15.2646  3.98055  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.585  15.2646  3.98055  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2819 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.805  15.2646  3.98055  0.55
protocols.relax.FastRelax: {0} CMD: min  -239.658  15.3674  4.29915  0.55
protocols.relax.FastRelax: {0} MRP: 1  -239.658  -239.658  15.3674  4.29915
protocols.relax.FastRelax: {0} CMD: accept_to_best  -239.658  15.3674  4.29915  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -239.658  15.3674  4.29915  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.658  15.3674  4.29915  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -303.117  15.3674  4.29915  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2755 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -313.561  15.3674  4.29915  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -310.752  15.3674  4.29915  0.02805
protocols.relax.FastRelax: {0} CMD: min  -373.936  15.0655  3.75611  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -373.936  15.0655  3.75611  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.061  15.0655  3.75611  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2854 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.638  15.0655  3.75611  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.022  15.0655  3.75611  0.154
protocols.relax.FastRelax: {0} CMD: min  -303.941  15.1927  3.92288  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -303.941  15.1927  3.92288  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.761  15.1927  3.92288  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2715 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -258.932  15.1927  3.92288  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.385  15.1927  3.92288  0.31955
protocols.relax.FastRelax: {0} CMD: min  -267.364  15.2743  4.11487  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.364  15.2743  4.11487  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.32  15.2743  4.11487  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2617 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.379  15.2743  4.11487  0.55
protocols.relax.FastRelax: {0} CMD: min  -244.48  15.2486  4.25912  0.55
protocols.relax.FastRelax: {0} MRP: 2  -244.48  -244.48  15.2486  4.25912
protocols.relax.FastRelax: {0} CMD: accept_to_best  -244.48  15.2486  4.25912  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -244.48  15.2486  4.25912  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.48  15.2486  4.25912  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -308.135  15.2486  4.25912  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2840 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -316.638  15.2486  4.25912  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -315.225  15.2486  4.25912  0.02805
protocols.relax.FastRelax: {0} CMD: min  -363.897  15.0531  3.65231  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -363.897  15.0531  3.65231  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.069  15.0531  3.65231  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2901 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -247.071  15.0531  3.65231  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.547  15.0531  3.65231  0.154
protocols.relax.FastRelax: {0} CMD: min  -304.812  15.1685  3.94796  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -304.812  15.1685  3.94796  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.088  15.1685  3.94796  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2678 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -262.493  15.1685  3.94796  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.14  15.1685  3.94796  0.31955
protocols.relax.FastRelax: {0} CMD: min  -269.293  15.1761  4.01272  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -269.293  15.1761  4.01272  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.968  15.1761  4.01272  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2617 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.185  15.1761  4.01272  0.55
protocols.relax.FastRelax: {0} CMD: min  -243.704  15.1836  4.16381  0.55
protocols.relax.FastRelax: {0} MRP: 3  -243.704  -244.48  15.2486  4.25912
protocols.relax.FastRelax: {0} CMD: accept_to_best  -243.704  15.1836  4.16381  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -243.704  15.1836  4.16381  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.704  15.1836  4.16381  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -307.718  15.1836  4.16381  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2759 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -318.986  15.1836  4.16381  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -317.232  15.1836  4.16381  0.02805
protocols.relax.FastRelax: {0} CMD: min  -366.988  14.9734  3.46719  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -366.988  14.9734  3.46719  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.817  14.9734  3.46719  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2887 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -252.39  14.9734  3.46719  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.943  14.9734  3.46719  0.154
protocols.relax.FastRelax: {0} CMD: min  -304.841  15.0947  3.87169  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -304.841  15.0947  3.87169  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.357  15.0947  3.87169  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2675 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.282  15.0947  3.87169  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.826  15.0947  3.87169  0.31955
protocols.relax.FastRelax: {0} CMD: min  -268.337  15.1752  3.96046  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.337  15.1752  3.96046  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.515  15.1752  3.96046  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2610 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.414  15.1752  3.96046  0.55
protocols.relax.FastRelax: {0} CMD: min  -244.721  15.1721  4.27431  0.55
protocols.relax.FastRelax: {0} MRP: 4  -244.721  -244.721  15.1721  4.27431
protocols.relax.FastRelax: {0} CMD: accept_to_best  -244.721  15.1721  4.27431  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -244.721  15.1721  4.27431  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_44.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71290.9  10.5642  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71290.9  10.5642  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7692.9  10.5642  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2810 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  225.36  10.5642  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  275.898  10.5642  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -225.037  12.2074  12.7457  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.037  12.2074  12.7457  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -133.851  12.2074  12.7457  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2074 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -153.025  12.2074  12.7457  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -148.763  12.2074  12.7457  0.154
protocols.relax.FastRelax: {0} CMD: min  -181.531  13.3818  14.517  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -181.531  13.3818  14.517  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -146.415  13.3818  14.517  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2012 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -147.136  13.3818  14.517  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -144.405  13.3818  14.517  0.31955
protocols.relax.FastRelax: {0} CMD: min  -174.46  13.8632  15.0802  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -174.46  13.8632  15.0802  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -144.207  13.8632  15.0802  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1953 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -144.408  13.8632  15.0802  0.55
protocols.relax.FastRelax: {0} CMD: min  -169.819  12.8691  12.8279  0.55
protocols.relax.FastRelax: {0} MRP: 0  -169.819  -169.819  12.8691  12.8279
protocols.relax.FastRelax: {0} CMD: accept_to_best  -169.819  12.8691  12.8279  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -169.819  12.8691  12.8279  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -169.819  12.8691  12.8279  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.433  12.8691  12.8279  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2145 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.114  12.8691  12.8279  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.636  12.8691  12.8279  0.02805
protocols.relax.FastRelax: {0} CMD: min  -257.856  12.1279  12.7697  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.856  12.1279  12.7697  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.499  12.1279  12.7697  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2058 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -204.419  12.1279  12.7697  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.151  12.1279  12.7697  0.154
protocols.relax.FastRelax: {0} CMD: min  -223.834  12.3743  12.9918  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.834  12.3743  12.9918  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.33  12.3743  12.9918  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2010 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.658  12.3743  12.9918  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.454  12.3743  12.9918  0.31955
protocols.relax.FastRelax: {0} CMD: min  -200.124  12.9487  13.5659  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.124  12.9487  13.5659  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.449  12.9487  13.5659  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1998 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -166.416  12.9487  13.5659  0.55
protocols.relax.FastRelax: {0} CMD: min  -187.666  13.928  14.2971  0.55
protocols.relax.FastRelax: {0} MRP: 1  -187.666  -187.666  13.928  14.2971
protocols.relax.FastRelax: {0} CMD: accept_to_best  -187.666  13.928  14.2971  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -187.666  13.928  14.2971  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -187.666  13.928  14.2971  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.181  13.928  14.2971  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2164 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -249.331  13.928  14.2971  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.318  13.928  14.2971  0.02805
protocols.relax.FastRelax: {0} CMD: min  -274.001  12.9742  12.4839  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.001  12.9742  12.4839  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.226  12.9742  12.4839  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2190 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.642  12.9742  12.4839  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.86  12.9742  12.4839  0.154
protocols.relax.FastRelax: {0} CMD: min  -238.353  13.1568  12.8812  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.353  13.1568  12.8812  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.361  13.1568  12.8812  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1998 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.437  13.1568  12.8812  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.074  13.1568  12.8812  0.31955
protocols.relax.FastRelax: {0} CMD: min  -208.097  13.198  13.0224  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.097  13.198  13.0224  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -167.373  13.198  13.0224  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1982 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -168.343  13.198  13.0224  0.55
protocols.relax.FastRelax: {0} CMD: min  -193.646  13.3747  13.5906  0.55
protocols.relax.FastRelax: {0} MRP: 2  -193.646  -193.646  13.3747  13.5906
protocols.relax.FastRelax: {0} CMD: accept_to_best  -193.646  13.3747  13.5906  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -193.646  13.3747  13.5906  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.646  13.3747  13.5906  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.249  13.3747  13.5906  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2134 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -255.006  13.3747  13.5906  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.349  13.3747  13.5906  0.02805
protocols.relax.FastRelax: {0} CMD: min  -274.732  12.5115  12.2087  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.732  12.5115  12.2087  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.385  12.5115  12.2087  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2146 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.432  12.5115  12.2087  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.099  12.5115  12.2087  0.154
protocols.relax.FastRelax: {0} CMD: min  -242.752  12.9011  12.8354  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.752  12.9011  12.8354  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.698  12.9011  12.8354  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2043 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.046  12.9011  12.8354  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.572  12.9011  12.8354  0.31955
protocols.relax.FastRelax: {0} CMD: min  -211.464  12.8803  12.977  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.464  12.8803  12.977  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.405  12.8803  12.977  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2022 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -169.998  12.8803  12.977  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.141  13.5988  14.6631  0.55
protocols.relax.FastRelax: {0} MRP: 3  -201.141  -201.141  13.5988  14.6631
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.141  13.5988  14.6631  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.141  13.5988  14.6631  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -201.141  13.5988  14.6631  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.005  13.5988  14.6631  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2140 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -261.591  13.5988  14.6631  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.902  13.5988  14.6631  0.02805
protocols.relax.FastRelax: {0} CMD: min  -288.038  12.7797  13.4515  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -288.038  12.7797  13.4515  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.617  12.7797  13.4515  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2385 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.255  12.7797  13.4515  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.943  12.7797  13.4515  0.154
protocols.relax.FastRelax: {0} CMD: min  -249.168  13.0691  14.0131  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.168  13.0691  14.0131  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.701  13.0691  14.0131  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2137 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.125  13.0691  14.0131  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.578  13.0691  14.0131  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.858  13.4896  14.5371  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.858  13.4896  14.5371  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.793  13.4896  14.5371  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2025 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.977  13.4896  14.5371  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.831  13.6437  14.6618  0.55
protocols.relax.FastRelax: {0} MRP: 4  -201.831  -201.831  13.6437  14.6618
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.831  13.6437  14.6618  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.831  13.6437  14.6618  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_30.pdb
protocols.relax.FastRelax: {0} CMD: repeat  74335.8  18.7045  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  74335.8  18.7045  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7339.68  18.7045  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3282 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -39.3566  18.7045  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -5.43922  18.7045  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -245.088  17.3374  5.537  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.088  17.3374  5.537  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -121.592  17.3374  5.537  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2588 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -152.154  17.3374  5.537  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -145.621  17.3374  5.537  0.154
protocols.relax.FastRelax: {0} CMD: min  -225.154  18.0009  4.11675  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.154  18.0009  4.11675  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.8  18.0009  4.11675  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2472 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -190.996  18.0009  4.11675  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.069  18.0009  4.11675  0.31955
protocols.relax.FastRelax: {0} CMD: min  -195.939  17.8133  4.59331  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -195.939  17.8133  4.59331  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.103  17.8133  4.59331  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2427 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -151.768  17.8133  4.59331  0.55
protocols.relax.FastRelax: {0} CMD: min  -205.055  16.3461  8.46393  0.55
protocols.relax.FastRelax: {0} MRP: 0  -205.055  -205.055  16.3461  8.46393
protocols.relax.FastRelax: {0} CMD: accept_to_best  -205.055  16.3461  8.46393  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -205.055  16.3461  8.46393  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.055  16.3461  8.46393  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.908  16.3461  8.46393  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2637 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -277.416  16.3461  8.46393  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.181  16.3461  8.46393  0.02805
protocols.relax.FastRelax: {0} CMD: min  -334.73  16.4817  7.20721  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -334.73  16.4817  7.20721  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.374  16.4817  7.20721  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2916 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.16  16.4817  7.20721  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.901  16.4817  7.20721  0.154
protocols.relax.FastRelax: {0} CMD: min  -266.056  16.4981  7.54346  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -266.056  16.4981  7.54346  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.936  16.4981  7.54346  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2661 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.126  16.4981  7.54346  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.545  16.4981  7.54346  0.31955
protocols.relax.FastRelax: {0} CMD: min  -228.803  16.3633  8.23102  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.803  16.3633  8.23102  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.727  16.3633  8.23102  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2546 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.127  16.3633  8.23102  0.55
protocols.relax.FastRelax: {0} CMD: min  -216.571  16.171  8.55533  0.55
protocols.relax.FastRelax: {0} MRP: 1  -216.571  -216.571  16.171  8.55533
protocols.relax.FastRelax: {0} CMD: accept_to_best  -216.571  16.171  8.55533  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -216.571  16.171  8.55533  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.571  16.171  8.55533  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.822  16.171  8.55533  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2581 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -291.48  16.171  8.55533  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.973  16.171  8.55533  0.02805
protocols.relax.FastRelax: {0} CMD: min  -339.436  15.849  8.79468  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -339.436  15.849  8.79468  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.97  15.849  8.79468  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2866 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.642  15.849  8.79468  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.86  15.849  8.79468  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.863  15.8628  9.25888  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.863  15.8628  9.25888  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.534  15.8628  9.25888  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2526 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.027  15.8628  9.25888  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.593  15.8628  9.25888  0.31955
protocols.relax.FastRelax: {0} CMD: min  -243.14  16.0501  9.0571  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.14  16.0501  9.0571  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.819  16.0501  9.0571  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2565 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.64  16.0501  9.0571  0.55
protocols.relax.FastRelax: {0} CMD: min  -224.321  16.0517  9.10733  0.55
protocols.relax.FastRelax: {0} MRP: 2  -224.321  -224.321  16.0517  9.10733
protocols.relax.FastRelax: {0} CMD: accept_to_best  -224.321  16.0517  9.10733  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -224.321  16.0517  9.10733  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.321  16.0517  9.10733  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.185  16.0517  9.10733  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2568 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -297.661  16.0517  9.10733  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -295.472  16.0517  9.10733  0.02805
protocols.relax.FastRelax: {0} CMD: min  -332.76  15.9407  8.65569  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -332.76  15.9407  8.65569  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.768  15.9407  8.65569  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2586 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -249.951  15.9407  8.65569  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.658  15.9407  8.65569  0.154
protocols.relax.FastRelax: {0} CMD: min  -285.449  15.8032  9.14444  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -285.449  15.8032  9.14444  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.598  15.8032  9.14444  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2538 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -247.139  15.8032  9.14444  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.091  15.8032  9.14444  0.31955
protocols.relax.FastRelax: {0} CMD: min  -253.187  15.8017  9.34887  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.187  15.8017  9.34887  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.27  15.8017  9.34887  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2458 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.289  15.8017  9.34887  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.313  15.4673  9.80393  0.55
protocols.relax.FastRelax: {0} MRP: 3  -230.313  -230.313  15.4673  9.80393
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.313  15.4673  9.80393  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.313  15.4673  9.80393  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.313  15.4673  9.80393  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.264  15.4673  9.80393  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2577 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -301.809  15.4673  9.80393  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -300.039  15.4673  9.80393  0.02805
protocols.relax.FastRelax: {0} CMD: min  -338.419  15.2693  9.35672  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -338.419  15.2693  9.35672  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.781  15.2693  9.35672  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2749 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.57  15.2693  9.35672  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.703  15.2693  9.35672  0.154
protocols.relax.FastRelax: {0} CMD: min  -291.088  15.1986  9.81909  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -291.088  15.1986  9.81909  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.436  15.1986  9.81909  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2571 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -246.527  15.1986  9.81909  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.945  15.1986  9.81909  0.31955
protocols.relax.FastRelax: {0} CMD: min  -256.382  15.2834  9.88868  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.382  15.2834  9.88868  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.289  15.2834  9.88868  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2414 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.646  15.2834  9.88868  0.55
protocols.relax.FastRelax: {0} CMD: min  -239.517  15.1713  10.031  0.55
protocols.relax.FastRelax: {0} MRP: 4  -239.517  -239.517  15.1713  10.031
protocols.relax.FastRelax: {0} CMD: accept_to_best  -239.517  15.1713  10.031  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -239.517  15.1713  10.031  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_0.pdb
protocols.relax.FastRelax: {0} CMD: repeat  76053.2  16.7607  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  76053.2  16.7607  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7268.07  16.7607  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3020 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -130.797  16.7607  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -105.811  16.7607  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -277.131  16.3177  1.46671  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.131  16.3177  1.46671  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -136.83  16.3177  1.46671  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2983 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -166.543  16.3177  1.46671  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.688  16.3177  1.46671  0.154
protocols.relax.FastRelax: {0} CMD: min  -215.859  16.3169  1.62663  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.859  16.3169  1.62663  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.487  16.3169  1.62663  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2851 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.936  16.3169  1.62663  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.476  16.3169  1.62663  0.31955
protocols.relax.FastRelax: {0} CMD: min  -180.213  16.2322  1.70398  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -180.213  16.2322  1.70398  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -126.668  16.2322  1.70398  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2550 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -128.257  16.2322  1.70398  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.032  16.5631  2.25486  0.55
protocols.relax.FastRelax: {0} MRP: 0  -217.032  -217.032  16.5631  2.25486
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.032  16.5631  2.25486  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.032  16.5631  2.25486  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.032  16.5631  2.25486  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.702  16.5631  2.25486  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3240 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -289.493  16.5631  2.25486  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.983  16.5631  2.25486  0.02805
protocols.relax.FastRelax: {0} CMD: min  -334.96  16.6201  2.68556  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -334.96  16.6201  2.68556  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.577  16.6201  2.68556  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3309 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.195  16.6201  2.68556  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.372  16.6201  2.68556  0.154
protocols.relax.FastRelax: {0} CMD: min  -278.422  16.6838  2.52315  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -278.422  16.6838  2.52315  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.3  16.6838  2.52315  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3033 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.91  16.6838  2.52315  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.567  16.6838  2.52315  0.31955
protocols.relax.FastRelax: {0} CMD: min  -248.184  16.6859  2.40928  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.184  16.6859  2.40928  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.627  16.6859  2.40928  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2845 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.791  16.6859  2.40928  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.089  16.6158  2.35698  0.55
protocols.relax.FastRelax: {0} MRP: 1  -230.089  -230.089  16.6158  2.35698
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.089  16.6158  2.35698  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.089  16.6158  2.35698  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.089  16.6158  2.35698  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -290.977  16.6158  2.35698  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3326 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -299.701  16.6158  2.35698  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -297.868  16.6158  2.35698  0.02805
protocols.relax.FastRelax: {0} CMD: min  -343.186  16.5462  2.63622  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -343.186  16.5462  2.63622  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.944  16.5462  2.63622  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3455 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -246.809  16.5462  2.63622  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.667  16.5462  2.63622  0.154
protocols.relax.FastRelax: {0} CMD: min  -291.423  16.563  2.51122  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -291.423  16.563  2.51122  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.42  16.563  2.51122  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3018 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -253.811  16.563  2.51122  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.819  16.563  2.51122  0.31955
protocols.relax.FastRelax: {0} CMD: min  -257.523  16.5736  2.49049  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.523  16.5736  2.49049  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.714  16.5736  2.49049  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2845 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.065  16.5736  2.49049  0.55
protocols.relax.FastRelax: {0} CMD: min  -236.875  16.5674  2.6427  0.55
protocols.relax.FastRelax: {0} MRP: 2  -236.875  -236.875  16.5674  2.6427
protocols.relax.FastRelax: {0} CMD: accept_to_best  -236.875  16.5674  2.6427  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -236.875  16.5674  2.6427  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.875  16.5674  2.6427  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.445  16.5674  2.6427  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3369 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -305.948  16.5674  2.6427  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -303.68  16.5674  2.6427  0.02805
protocols.relax.FastRelax: {0} CMD: min  -347.627  16.4347  2.86251  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -347.627  16.4347  2.86251  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.532  16.4347  2.86251  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3376 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -257.206  16.4347  2.86251  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.621  16.4347  2.86251  0.154
protocols.relax.FastRelax: {0} CMD: min  -294.932  16.4374  2.74136  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -294.932  16.4374  2.74136  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.59  16.4374  2.74136  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3078 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -257.04  16.4374  2.74136  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.048  16.4374  2.74136  0.31955
protocols.relax.FastRelax: {0} CMD: min  -262.543  16.4543  2.66755  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.543  16.4543  2.66755  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.126  16.4543  2.66755  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3039 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.276  16.4543  2.66755  0.55
protocols.relax.FastRelax: {0} CMD: min  -240.933  16.5407  2.60824  0.55
protocols.relax.FastRelax: {0} MRP: 3  -240.933  -240.933  16.5407  2.60824
protocols.relax.FastRelax: {0} CMD: accept_to_best  -240.933  16.5407  2.60824  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -240.933  16.5407  2.60824  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -240.933  16.5407  2.60824  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -302.607  16.5407  2.60824  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3450 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -309.755  16.5407  2.60824  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -307.93  16.5407  2.60824  0.02805
protocols.relax.FastRelax: {0} CMD: min  -349.729  16.4285  2.78245  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -349.729  16.4285  2.78245  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.18  16.4285  2.78245  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3417 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.402  16.4285  2.78245  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.346  16.4285  2.78245  0.154
protocols.relax.FastRelax: {0} CMD: min  -295.42  16.3963  2.80019  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -295.42  16.3963  2.80019  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.276  16.3963  2.80019  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3160 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.935  16.3963  2.80019  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.686  16.3963  2.80019  0.31955
protocols.relax.FastRelax: {0} CMD: min  -267.858  16.4601  2.64405  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.858  16.4601  2.64405  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.937  16.4601  2.64405  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3017 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.046  16.4601  2.64405  0.55
protocols.relax.FastRelax: {0} CMD: min  -244.058  16.5216  2.60522  0.55
protocols.relax.FastRelax: {0} MRP: 4  -244.058  -244.058  16.5216  2.60522
protocols.relax.FastRelax: {0} CMD: accept_to_best  -244.058  16.5216  2.60522  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -244.058  16.5216  2.60522  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_18.pdb
protocols.relax.FastRelax: {0} CMD: repeat  67288  12.8997  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  67288  12.8997  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6861.49  12.8997  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2874 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -71.2781  12.8997  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -44.054  12.8997  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -251.699  13.4849  3.52802  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.699  13.4849  3.52802  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -112.641  13.4849  3.52802  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2910 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -160.461  13.4849  3.52802  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.932  13.4849  3.52802  0.154
protocols.relax.FastRelax: {0} CMD: min  -230.382  13.5238  3.70934  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.382  13.5238  3.70934  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.694  13.5238  3.70934  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2776 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -193.443  13.5238  3.70934  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.468  13.5238  3.70934  0.31955
protocols.relax.FastRelax: {0} CMD: min  -197.632  13.5653  3.67736  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.632  13.5653  3.67736  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -154.888  13.5653  3.67736  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2716 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -155.296  13.5653  3.67736  0.55
protocols.relax.FastRelax: {0} CMD: min  -202.449  13.8591  3.75707  0.55
protocols.relax.FastRelax: {0} MRP: 0  -202.449  -202.449  13.8591  3.75707
protocols.relax.FastRelax: {0} CMD: accept_to_best  -202.449  13.8591  3.75707  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -202.449  13.8591  3.75707  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.449  13.8591  3.75707  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.928  13.8591  3.75707  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3135 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -280.263  13.8591  3.75707  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.137  13.8591  3.75707  0.02805
protocols.relax.FastRelax: {0} CMD: min  -322.067  13.7179  4.12522  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -322.067  13.7179  4.12522  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.382  13.7179  4.12522  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3128 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.928  13.7179  4.12522  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.313  13.7179  4.12522  0.154
protocols.relax.FastRelax: {0} CMD: min  -271.239  13.8271  4.14535  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.239  13.8271  4.14535  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.499  13.8271  4.14535  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3007 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.002  13.8271  4.14535  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.03  13.8271  4.14535  0.31955
protocols.relax.FastRelax: {0} CMD: min  -237.047  13.8652  4.08111  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.047  13.8652  4.08111  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.365  13.8652  4.08111  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2930 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.001  13.8652  4.08111  0.55
protocols.relax.FastRelax: {0} CMD: min  -216.683  13.8861  4.08664  0.55
protocols.relax.FastRelax: {0} MRP: 1  -216.683  -216.683  13.8861  4.08664
protocols.relax.FastRelax: {0} CMD: accept_to_best  -216.683  13.8861  4.08664  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -216.683  13.8861  4.08664  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.683  13.8861  4.08664  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.809  13.8861  4.08664  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3058 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -285.841  13.8861  4.08664  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.669  13.8861  4.08664  0.02805
protocols.relax.FastRelax: {0} CMD: min  -333.999  13.7994  4.26061  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -333.999  13.7994  4.26061  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.715  13.7994  4.26061  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3073 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.059  13.7994  4.26061  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.638  13.7994  4.26061  0.154
protocols.relax.FastRelax: {0} CMD: min  -271.793  13.8383  4.17212  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.793  13.8383  4.17212  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.524  13.8383  4.17212  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2914 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.391  13.8383  4.17212  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.083  13.8383  4.17212  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.645  13.8531  4.07876  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.645  13.8531  4.07876  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.082  13.8531  4.07876  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2747 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -202.159  13.8531  4.07876  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.425  13.832  4.03458  0.55
protocols.relax.FastRelax: {0} MRP: 2  -217.425  -217.425  13.832  4.03458
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.425  13.832  4.03458  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.425  13.832  4.03458  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.425  13.832  4.03458  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.191  13.832  4.03458  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3179 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -288.804  13.832  4.03458  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.084  13.832  4.03458  0.02805
protocols.relax.FastRelax: {0} CMD: min  -336.141  13.7933  4.3062  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -336.141  13.7933  4.3062  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.8  13.7933  4.3062  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3170 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.051  13.7933  4.3062  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.582  13.7933  4.3062  0.154
protocols.relax.FastRelax: {0} CMD: min  -278.385  13.8391  4.11548  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -278.385  13.8391  4.11548  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.092  13.8391  4.11548  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2926 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.715  13.8391  4.11548  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.613  13.8391  4.11548  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.114  13.8568  4.07918  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.114  13.8568  4.07918  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.497  13.8568  4.07918  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2768 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.627  13.8568  4.07918  0.55
protocols.relax.FastRelax: {0} CMD: min  -222.373  13.847  4.02497  0.55
protocols.relax.FastRelax: {0} MRP: 3  -222.373  -222.373  13.847  4.02497
protocols.relax.FastRelax: {0} CMD: accept_to_best  -222.373  13.847  4.02497  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -222.373  13.847  4.02497  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.373  13.847  4.02497  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.328  13.847  4.02497  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3218 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -291.217  13.847  4.02497  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.466  13.847  4.02497  0.02805
protocols.relax.FastRelax: {0} CMD: min  -334.203  13.7613  4.23698  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -334.203  13.7613  4.23698  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.243  13.7613  4.23698  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3160 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.486  13.7613  4.23698  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.173  13.7613  4.23698  0.154
protocols.relax.FastRelax: {0} CMD: min  -276.466  13.8215  4.10253  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -276.466  13.8215  4.10253  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.676  13.8215  4.10253  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2936 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.493  13.8215  4.10253  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.458  13.8215  4.10253  0.31955
protocols.relax.FastRelax: {0} CMD: min  -248.212  13.8254  4.04203  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.212  13.8254  4.04203  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.75  13.8254  4.04203  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2855 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.043  13.8254  4.04203  0.55
protocols.relax.FastRelax: {0} CMD: min  -222.746  13.8013  3.98694  0.55
protocols.relax.FastRelax: {0} MRP: 4  -222.746  -222.746  13.8013  3.98694
protocols.relax.FastRelax: {0} CMD: accept_to_best  -222.746  13.8013  3.98694  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -222.746  13.8013  3.98694  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_8.pdb
protocols.relax.FastRelax: {0} CMD: repeat  64560.9  17.4389  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  64560.9  17.4389  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6849.79  17.4389  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2978 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -130.435  17.4389  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -117.517  17.4389  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -262.721  17.3842  3.03773  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.721  17.3842  3.03773  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -104.222  17.3842  3.03773  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2943 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.829  17.3842  3.03773  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -155.49  17.3842  3.03773  0.154
protocols.relax.FastRelax: {0} CMD: min  -207.988  17.3122  2.88676  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -207.988  17.3122  2.88676  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.345  17.3122  2.88676  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2929 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -164.308  17.3122  2.88676  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160.825  17.3122  2.88676  0.31955
protocols.relax.FastRelax: {0} CMD: min  -184.763  17.3019  2.84841  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -184.763  17.3019  2.84841  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -145.569  17.3019  2.84841  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2671 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -145.604  17.3019  2.84841  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.751  17.1437  2.96022  0.55
protocols.relax.FastRelax: {0} MRP: 0  -194.751  -194.751  17.1437  2.96022
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.751  17.1437  2.96022  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.751  17.1437  2.96022  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.751  17.1437  2.96022  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.693  17.1437  2.96022  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3024 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.595  17.1437  2.96022  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.024  17.1437  2.96022  0.02805
protocols.relax.FastRelax: {0} CMD: min  -318.365  16.8134  3.20865  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -318.365  16.8134  3.20865  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.387  16.8134  3.20865  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2804 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.867  16.8134  3.20865  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.727  16.8134  3.20865  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.152  17.0716  3.30862  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.152  17.0716  3.30862  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.001  17.0716  3.30862  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2715 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.925  17.0716  3.30862  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.572  17.0716  3.30862  0.31955
protocols.relax.FastRelax: {0} CMD: min  -226.194  17.0899  3.184  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.194  17.0899  3.184  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.241  17.0899  3.184  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2535 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.788  17.0899  3.184  0.55
protocols.relax.FastRelax: {0} CMD: min  -216.001  16.607  3.44743  0.55
protocols.relax.FastRelax: {0} MRP: 1  -216.001  -216.001  16.607  3.44743
protocols.relax.FastRelax: {0} CMD: accept_to_best  -216.001  16.607  3.44743  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -216.001  16.607  3.44743  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.001  16.607  3.44743  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.536  16.607  3.44743  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2927 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -291.604  16.607  3.44743  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.988  16.607  3.44743  0.02805
protocols.relax.FastRelax: {0} CMD: min  -325.823  16.4038  3.56406  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -325.823  16.4038  3.56406  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.332  16.4038  3.56406  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2824 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.515  16.4038  3.56406  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.231  16.4038  3.56406  0.154
protocols.relax.FastRelax: {0} CMD: min  -273.43  16.5321  3.47285  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.43  16.5321  3.47285  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.006  16.5321  3.47285  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2767 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.421  16.5321  3.47285  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.244  16.5321  3.47285  0.31955
protocols.relax.FastRelax: {0} CMD: min  -238.262  16.6041  3.44873  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.262  16.6041  3.44873  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.386  16.6041  3.44873  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2468 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -193.703  16.6041  3.44873  0.55
protocols.relax.FastRelax: {0} CMD: min  -220.972  16.5056  3.47242  0.55
protocols.relax.FastRelax: {0} MRP: 2  -220.972  -220.972  16.5056  3.47242
protocols.relax.FastRelax: {0} CMD: accept_to_best  -220.972  16.5056  3.47242  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -220.972  16.5056  3.47242  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.972  16.5056  3.47242  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.383  16.5056  3.47242  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2950 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -298.408  16.5056  3.47242  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -295.875  16.5056  3.47242  0.02805
protocols.relax.FastRelax: {0} CMD: min  -332.309  16.2614  3.65061  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -332.309  16.2614  3.65061  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.605  16.2614  3.65061  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2897 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.865  16.2614  3.65061  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.001  16.2614  3.65061  0.154
protocols.relax.FastRelax: {0} CMD: min  -279.056  16.3976  3.48294  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -279.056  16.3976  3.48294  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.606  16.3976  3.48294  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2725 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.15  16.3976  3.48294  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.956  16.3976  3.48294  0.31955
protocols.relax.FastRelax: {0} CMD: min  -248.578  16.5122  3.51363  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.578  16.5122  3.51363  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.08  16.5122  3.51363  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2670 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.095  16.5122  3.51363  0.55
protocols.relax.FastRelax: {0} CMD: min  -228.372  16.5209  3.53042  0.55
protocols.relax.FastRelax: {0} MRP: 3  -228.372  -228.372  16.5209  3.53042
protocols.relax.FastRelax: {0} CMD: accept_to_best  -228.372  16.5209  3.53042  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -228.372  16.5209  3.53042  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.372  16.5209  3.53042  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -291.539  16.5209  3.53042  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3086 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -301.564  16.5209  3.53042  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -299.633  16.5209  3.53042  0.02805
protocols.relax.FastRelax: {0} CMD: min  -346.418  16.2284  3.74564  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -346.418  16.2284  3.74564  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.201  16.2284  3.74564  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2810 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.393  16.2284  3.74564  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.229  16.2284  3.74564  0.154
protocols.relax.FastRelax: {0} CMD: min  -286.93  16.3894  3.64876  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -286.93  16.3894  3.64876  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.012  16.3894  3.64876  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2743 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -245.468  16.3894  3.64876  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.183  16.3894  3.64876  0.31955
protocols.relax.FastRelax: {0} CMD: min  -251.367  16.5003  3.61406  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.367  16.5003  3.61406  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.993  16.5003  3.61406  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2626 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.111  16.5003  3.61406  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.034  16.5139  3.51642  0.55
protocols.relax.FastRelax: {0} MRP: 4  -226.034  -228.372  16.5209  3.53042
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.034  16.5139  3.51642  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.034  16.5139  3.51642  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_27.pdb
protocols.relax.FastRelax: {0} CMD: repeat  78857.8  13.915  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  78857.8  13.915  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  8039.06  13.915  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2714 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  183.478  13.915  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  230.527  13.915  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -199.272  11.7227  6.2057  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -199.272  11.7227  6.2057  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -56.2973  11.7227  6.2057  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2156 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -107.949  11.7227  6.2057  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -101.696  11.7227  6.2057  0.154
protocols.relax.FastRelax: {0} CMD: min  232.052  13.1253  5.96985  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  232.052  13.1253  5.96985  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  706.605  13.1253  5.96985  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2308 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -129.851  13.1253  5.96985  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -126.189  13.1253  5.96985  0.31955
protocols.relax.FastRelax: {0} CMD: min  -177.653  12.8332  6.28296  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -177.653  12.8332  6.28296  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -136.525  12.8332  6.28296  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2051 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -136.75  12.8332  6.28296  0.55
protocols.relax.FastRelax: {0} CMD: min  -162.981  12.8208  6.3789  0.55
protocols.relax.FastRelax: {0} MRP: 0  -162.981  -162.981  12.8208  6.3789
protocols.relax.FastRelax: {0} CMD: accept_to_best  -162.981  12.8208  6.3789  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -162.981  12.8208  6.3789  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -162.981  12.8208  6.3789  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.726  12.8208  6.3789  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2232 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -244.844  12.8208  6.3789  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.885  12.8208  6.3789  0.02805
protocols.relax.FastRelax: {0} CMD: min  -304.493  12.8999  6.53424  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -304.493  12.8999  6.53424  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -150.561  12.8999  6.53424  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2712 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -171.411  12.8999  6.53424  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.266  12.8999  6.53424  0.154
protocols.relax.FastRelax: {0} CMD: min  -236.606  12.6804  6.59751  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.606  12.6804  6.59751  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.467  12.6804  6.59751  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2262 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -193.744  12.6804  6.59751  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.241  12.6804  6.59751  0.31955
protocols.relax.FastRelax: {0} CMD: min  -201.326  12.758  6.41397  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -201.326  12.758  6.41397  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -152.849  12.758  6.41397  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2059 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -153.299  12.758  6.41397  0.55
protocols.relax.FastRelax: {0} CMD: min  -193.119  12.9157  6.71341  0.55
protocols.relax.FastRelax: {0} MRP: 1  -193.119  -193.119  12.9157  6.71341
protocols.relax.FastRelax: {0} CMD: accept_to_best  -193.119  12.9157  6.71341  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -193.119  12.9157  6.71341  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.119  12.9157  6.71341  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.7  12.9157  6.71341  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2372 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -270.212  12.9157  6.71341  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.869  12.9157  6.71341  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.124  12.6731  7.2169  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.124  12.6731  7.2169  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.746  12.6731  7.2169  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2582 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.142  12.6731  7.2169  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.818  12.6731  7.2169  0.154
protocols.relax.FastRelax: {0} CMD: min  -258.972  12.633  6.89483  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.972  12.633  6.89483  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.224  12.633  6.89483  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2484 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.319  12.633  6.89483  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.884  12.633  6.89483  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.164  12.7691  6.90294  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.164  12.7691  6.90294  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.842  12.7691  6.90294  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2203 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.971  12.7691  6.90294  0.55
protocols.relax.FastRelax: {0} CMD: min  -200.08  12.632  7.25043  0.55
protocols.relax.FastRelax: {0} MRP: 2  -200.08  -200.08  12.632  7.25043
protocols.relax.FastRelax: {0} CMD: accept_to_best  -200.08  12.632  7.25043  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -200.08  12.632  7.25043  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.08  12.632  7.25043  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.617  12.632  7.25043  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2429 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -277.366  12.632  7.25043  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.74  12.632  7.25043  0.02805
protocols.relax.FastRelax: {0} CMD: min  -325.97  12.1954  7.41179  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -325.97  12.1954  7.41179  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.053  12.1954  7.41179  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2629 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.322  12.1954  7.41179  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.653  12.1954  7.41179  0.154
protocols.relax.FastRelax: {0} CMD: min  -268.38  12.2898  7.27107  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.38  12.2898  7.27107  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.985  12.2898  7.27107  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2268 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.224  12.2898  7.27107  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.893  12.2898  7.27107  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.349  12.4017  7.09355  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.349  12.4017  7.09355  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.443  12.4017  7.09355  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2202 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.688  12.4017  7.09355  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.715  12.4176  7.28002  0.55
protocols.relax.FastRelax: {0} MRP: 3  -204.715  -204.715  12.4176  7.28002
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.715  12.4176  7.28002  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.715  12.4176  7.28002  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.715  12.4176  7.28002  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.649  12.4176  7.28002  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2536 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -280.046  12.4176  7.28002  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.358  12.4176  7.28002  0.02805
protocols.relax.FastRelax: {0} CMD: min  -320.253  12.3842  7.4345  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -320.253  12.3842  7.4345  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.601  12.3842  7.4345  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2646 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.898  12.3842  7.4345  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.461  12.3842  7.4345  0.154
protocols.relax.FastRelax: {0} CMD: min  -264.672  12.325  7.27536  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -264.672  12.325  7.27536  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.979  12.325  7.27536  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2429 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.792  12.325  7.27536  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.536  12.325  7.27536  0.31955
protocols.relax.FastRelax: {0} CMD: min  -233.287  12.3456  7.20308  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -233.287  12.3456  7.20308  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.721  12.3456  7.20308  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2263 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.745  12.3456  7.20308  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.956  12.3944  7.27611  0.55
protocols.relax.FastRelax: {0} MRP: 4  -204.956  -204.956  12.3944  7.27611
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.956  12.3944  7.27611  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.956  12.3944  7.27611  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_4.pdb
protocols.relax.FastRelax: {0} CMD: repeat  66889.5  15.6606  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  66889.5  15.6606  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6875.92  15.6606  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3502 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -105.659  15.6606  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -75.0813  15.6606  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -288.464  16.9077  3.1324  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -288.464  16.9077  3.1324  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -103.051  16.9077  3.1324  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3347 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -137.036  16.9077  3.1324  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -126.937  16.9077  3.1324  0.154
protocols.relax.FastRelax: {0} CMD: min  -224.356  17.0615  3.53072  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.356  17.0615  3.53072  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.394  17.0615  3.53072  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3137 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -168.837  17.0615  3.53072  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.469  17.0615  3.53072  0.31955
protocols.relax.FastRelax: {0} CMD: min  -194.331  17.0387  3.84626  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.331  17.0387  3.84626  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -145.135  17.0387  3.84626  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3046 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -145.241  17.0387  3.84626  0.55
protocols.relax.FastRelax: {0} CMD: min  -196.93  16.8155  5.45299  0.55
protocols.relax.FastRelax: {0} MRP: 0  -196.93  -196.93  16.8155  5.45299
protocols.relax.FastRelax: {0} CMD: accept_to_best  -196.93  16.8155  5.45299  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -196.93  16.8155  5.45299  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.93  16.8155  5.45299  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.143  16.8155  5.45299  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3359 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -286.165  16.8155  5.45299  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.862  16.8155  5.45299  0.02805
protocols.relax.FastRelax: {0} CMD: min  -350.327  16.681  5.18208  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -350.327  16.681  5.18208  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.13  16.681  5.18208  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3684 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.349  16.681  5.18208  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.632  16.681  5.18208  0.154
protocols.relax.FastRelax: {0} CMD: min  -277.819  16.6269  5.36183  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.819  16.6269  5.36183  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.371  16.6269  5.36183  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3195 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.027  16.6269  5.36183  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.954  16.6269  5.36183  0.31955
protocols.relax.FastRelax: {0} CMD: min  -233.262  16.6142  5.69574  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -233.262  16.6142  5.69574  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.858  16.6142  5.69574  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2848 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -181.462  16.6142  5.69574  0.55
protocols.relax.FastRelax: {0} CMD: min  -210.098  16.5782  6.09994  0.55
protocols.relax.FastRelax: {0} MRP: 1  -210.098  -210.098  16.5782  6.09994
protocols.relax.FastRelax: {0} CMD: accept_to_best  -210.098  16.5782  6.09994  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -210.098  16.5782  6.09994  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.098  16.5782  6.09994  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.112  16.5782  6.09994  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3460 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -301.463  16.5782  6.09994  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -297.947  16.5782  6.09994  0.02805
protocols.relax.FastRelax: {0} CMD: min  -350.787  16.5688  5.66459  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -350.787  16.5688  5.66459  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.586  16.5688  5.66459  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3894 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.156  16.5688  5.66459  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.054  16.5688  5.66459  0.154
protocols.relax.FastRelax: {0} CMD: min  -288.775  16.6119  5.82245  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -288.775  16.6119  5.82245  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.673  16.6119  5.82245  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3142 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.479  16.6119  5.82245  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.537  16.6119  5.82245  0.31955
protocols.relax.FastRelax: {0} CMD: min  -248.046  16.5912  5.94443  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.046  16.5912  5.94443  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.777  16.5912  5.94443  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2833 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.766  16.5912  5.94443  0.55
protocols.relax.FastRelax: {0} CMD: min  -221.414  16.4909  6.30363  0.55
protocols.relax.FastRelax: {0} MRP: 2  -221.414  -221.414  16.4909  6.30363
protocols.relax.FastRelax: {0} CMD: accept_to_best  -221.414  16.4909  6.30363  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -221.414  16.4909  6.30363  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.414  16.4909  6.30363  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -296.533  16.4909  6.30363  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3599 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -307.9  16.4909  6.30363  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -305.351  16.4909  6.30363  0.02805
protocols.relax.FastRelax: {0} CMD: min  -347.907  16.445  6.14639  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -347.907  16.445  6.14639  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.371  16.445  6.14639  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3670 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -252.371  16.445  6.14639  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.117  16.445  6.14639  0.154
protocols.relax.FastRelax: {0} CMD: min  -289.691  16.4332  6.21383  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -289.691  16.4332  6.21383  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.614  16.4332  6.21383  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2989 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.14  16.4332  6.21383  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.282  16.4332  6.21383  0.31955
protocols.relax.FastRelax: {0} CMD: min  -250.377  16.4572  6.28709  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.377  16.4572  6.28709  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.836  16.4572  6.28709  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2859 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.382  16.4572  6.28709  0.55
protocols.relax.FastRelax: {0} CMD: min  -223.294  16.5205  6.32311  0.55
protocols.relax.FastRelax: {0} MRP: 3  -223.294  -223.294  16.5205  6.32311
protocols.relax.FastRelax: {0} CMD: accept_to_best  -223.294  16.5205  6.32311  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -223.294  16.5205  6.32311  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.294  16.5205  6.32311  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -297.818  16.5205  6.32311  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3567 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -308.797  16.5205  6.32311  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -305.963  16.5205  6.32311  0.02805
protocols.relax.FastRelax: {0} CMD: min  -348.682  16.4266  6.03926  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -348.682  16.4266  6.03926  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.38  16.4266  6.03926  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3627 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.663  16.4266  6.03926  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.338  16.4266  6.03926  0.154
protocols.relax.FastRelax: {0} CMD: min  -292.764  16.465  6.20505  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -292.764  16.465  6.20505  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.585  16.465  6.20505  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3042 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -244.111  16.465  6.20505  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.254  16.465  6.20505  0.31955
protocols.relax.FastRelax: {0} CMD: min  -250.728  16.4684  6.26372  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.728  16.4684  6.26372  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.9  16.4684  6.26372  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2863 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.295  16.4684  6.26372  0.55
protocols.relax.FastRelax: {0} CMD: min  -222.958  16.52  6.2822  0.55
protocols.relax.FastRelax: {0} MRP: 4  -222.958  -223.294  16.5205  6.32311
protocols.relax.FastRelax: {0} CMD: accept_to_best  -222.958  16.52  6.2822  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -222.958  16.52  6.2822  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_14.pdb
protocols.relax.FastRelax: {0} CMD: repeat  73645.3  11.5887  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  73645.3  11.5887  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7583.79  11.5887  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2507 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  72.1776  11.5887  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  96.5244  11.5887  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -210.046  10.4918  3.49005  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.046  10.4918  3.49005  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  41.6123  10.4918  3.49005  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2513 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -71.5207  10.4918  3.49005  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -62.6044  10.4918  3.49005  0.154
protocols.relax.FastRelax: {0} CMD: min  -216.991  10.6104  4.85666  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.991  10.6104  4.85666  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.821  10.6104  4.85666  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2542 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -176.844  10.6104  4.85666  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.259  10.6104  4.85666  0.31955
protocols.relax.FastRelax: {0} CMD: min  -186.241  10.8865  4.52232  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -186.241  10.8865  4.52232  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -139.752  10.8865  4.52232  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2287 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -140.006  10.8865  4.52232  0.55
protocols.relax.FastRelax: {0} CMD: min  -190.732  10.057  4.57396  0.55
protocols.relax.FastRelax: {0} MRP: 0  -190.732  -190.732  10.057  4.57396
protocols.relax.FastRelax: {0} CMD: accept_to_best  -190.732  10.057  4.57396  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -190.732  10.057  4.57396  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -190.732  10.057  4.57396  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.612  10.057  4.57396  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2495 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -274.96  10.057  4.57396  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.15  10.057  4.57396  0.02805
protocols.relax.FastRelax: {0} CMD: min  -329.737  10.2446  5.00718  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -329.737  10.2446  5.00718  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.327  10.2446  5.00718  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2752 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.717  10.2446  5.00718  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.71  10.2446  5.00718  0.154
protocols.relax.FastRelax: {0} CMD: min  -258.761  10.4469  5.19539  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.761  10.4469  5.19539  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.518  10.4469  5.19539  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2442 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.31  10.4469  5.19539  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.563  10.4469  5.19539  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.719  10.8227  5.26394  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.719  10.8227  5.26394  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.896  10.8227  5.26394  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2367 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.014  10.8227  5.26394  0.55
protocols.relax.FastRelax: {0} CMD: min  -203.556  10.6026  5.21629  0.55
protocols.relax.FastRelax: {0} MRP: 1  -203.556  -203.556  10.6026  5.21629
protocols.relax.FastRelax: {0} CMD: accept_to_best  -203.556  10.6026  5.21629  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -203.556  10.6026  5.21629  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -203.556  10.6026  5.21629  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.959  10.6026  5.21629  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2558 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.545  10.6026  5.21629  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.173  10.6026  5.21629  0.02805
protocols.relax.FastRelax: {0} CMD: min  -325.409  10.4382  5.0266  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -325.409  10.4382  5.0266  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.613  10.4382  5.0266  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2687 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.107  10.4382  5.0266  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.475  10.4382  5.0266  0.154
protocols.relax.FastRelax: {0} CMD: min  -262.617  10.5151  4.68503  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.617  10.5151  4.68503  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.82  10.5151  4.68503  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2577 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.719  10.5151  4.68503  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.351  10.5151  4.68503  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.016  10.7057  4.76188  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.016  10.7057  4.76188  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.621  10.7057  4.76188  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2398 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -185.858  10.7057  4.76188  0.55
protocols.relax.FastRelax: {0} CMD: min  -207.612  10.4817  4.81194  0.55
protocols.relax.FastRelax: {0} MRP: 2  -207.612  -207.612  10.4817  4.81194
protocols.relax.FastRelax: {0} CMD: accept_to_best  -207.612  10.4817  4.81194  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -207.612  10.4817  4.81194  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -207.612  10.4817  4.81194  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.05  10.4817  4.81194  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2476 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -289.616  10.4817  4.81194  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.316  10.4817  4.81194  0.02805
protocols.relax.FastRelax: {0} CMD: min  -336.173  10.2902  4.74679  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -336.173  10.2902  4.74679  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -156.625  10.2902  4.74679  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2645 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.944  10.2902  4.74679  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.382  10.2902  4.74679  0.154
protocols.relax.FastRelax: {0} CMD: min  -274.074  10.4807  4.80283  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.074  10.4807  4.80283  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.576  10.4807  4.80283  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2516 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.902  10.4807  4.80283  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.087  10.4807  4.80283  0.31955
protocols.relax.FastRelax: {0} CMD: min  -235.148  10.4784  4.83122  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.148  10.4784  4.83122  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.268  10.4784  4.83122  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2338 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.47  10.4784  4.83122  0.55
protocols.relax.FastRelax: {0} CMD: min  -213.53  10.8071  4.6855  0.55
protocols.relax.FastRelax: {0} MRP: 3  -213.53  -213.53  10.8071  4.6855
protocols.relax.FastRelax: {0} CMD: accept_to_best  -213.53  10.8071  4.6855  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -213.53  10.8071  4.6855  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.53  10.8071  4.6855  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.303  10.8071  4.6855  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2520 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -293.324  10.8071  4.6855  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.906  10.8071  4.6855  0.02805
protocols.relax.FastRelax: {0} CMD: min  -338.328  10.5356  4.64168  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -338.328  10.5356  4.64168  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.516  10.5356  4.64168  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2741 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.126  10.5356  4.64168  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.376  10.5356  4.64168  0.154
protocols.relax.FastRelax: {0} CMD: min  -276.358  10.6485  4.69633  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -276.358  10.6485  4.69633  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.901  10.6485  4.69633  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2433 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.436  10.6485  4.69633  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.021  10.6485  4.69633  0.31955
protocols.relax.FastRelax: {0} CMD: min  -233.812  10.6785  4.65025  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -233.812  10.6785  4.65025  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.034  10.6785  4.65025  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2409 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -177.547  10.6785  4.65025  0.55
protocols.relax.FastRelax: {0} CMD: min  -211.555  10.7988  4.66753  0.55
protocols.relax.FastRelax: {0} MRP: 4  -211.555  -213.53  10.8071  4.6855
protocols.relax.FastRelax: {0} CMD: accept_to_best  -211.555  10.7988  4.66753  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -211.555  10.7988  4.66753  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_21.pdb
protocols.relax.FastRelax: {0} CMD: repeat  73667.3  12.5027  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  73667.3  12.5027  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7419.89  12.5027  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2783 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -41.9356  12.5027  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1.00247  12.5027  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -252.676  12.5961  2.66334  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.676  12.5961  2.66334  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -117.792  12.5961  2.66334  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2777 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -142.148  12.5961  2.66334  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -135.111  12.5961  2.66334  0.154
protocols.relax.FastRelax: {0} CMD: min  -221.974  12.4934  2.49072  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.974  12.4934  2.49072  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.344  12.4934  2.49072  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2550 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -188.496  12.4934  2.49072  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.659  12.4934  2.49072  0.31955
protocols.relax.FastRelax: {0} CMD: min  -196.142  12.453  2.44509  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.142  12.453  2.44509  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -157.376  12.453  2.44509  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2596 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -157.949  12.453  2.44509  0.55
protocols.relax.FastRelax: {0} CMD: min  -198.771  12.1638  2.71228  0.55
protocols.relax.FastRelax: {0} MRP: 0  -198.771  -198.771  12.1638  2.71228
protocols.relax.FastRelax: {0} CMD: accept_to_best  -198.771  12.1638  2.71228  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -198.771  12.1638  2.71228  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -198.771  12.1638  2.71228  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.342  12.1638  2.71228  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2651 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.331  12.1638  2.71228  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.464  12.1638  2.71228  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.09  12.2166  2.53772  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.09  12.2166  2.53772  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.268  12.2166  2.53772  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3144 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.827  12.2166  2.53772  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.479  12.2166  2.53772  0.154
protocols.relax.FastRelax: {0} CMD: min  -262.842  12.1882  2.46454  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.842  12.1882  2.46454  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.936  12.1882  2.46454  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2964 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.988  12.1882  2.46454  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.042  12.1882  2.46454  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.732  12.2362  2.51394  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.732  12.2362  2.51394  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.569  12.2362  2.51394  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2746 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -190.095  12.2362  2.51394  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.591  12.1548  2.28855  0.55
protocols.relax.FastRelax: {0} MRP: 1  -212.591  -212.591  12.1548  2.28855
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.591  12.1548  2.28855  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.591  12.1548  2.28855  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.591  12.1548  2.28855  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.942  12.1548  2.28855  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2651 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -279.826  12.1548  2.28855  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.927  12.1548  2.28855  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.506  12.0402  2.34492  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.506  12.0402  2.34492  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.043  12.0402  2.34492  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2994 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.864  12.0402  2.34492  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.323  12.0402  2.34492  0.154
protocols.relax.FastRelax: {0} CMD: min  -264.861  12.0736  2.26437  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -264.861  12.0736  2.26437  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.468  12.0736  2.26437  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2938 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.685  12.0736  2.26437  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.698  12.0736  2.26437  0.31955
protocols.relax.FastRelax: {0} CMD: min  -235.093  12.1122  2.26605  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.093  12.1122  2.26605  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.631  12.1122  2.26605  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2767 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.653  12.1122  2.26605  0.55
protocols.relax.FastRelax: {0} CMD: min  -215.851  12.1086  2.34126  0.55
protocols.relax.FastRelax: {0} MRP: 2  -215.851  -215.851  12.1086  2.34126
protocols.relax.FastRelax: {0} CMD: accept_to_best  -215.851  12.1086  2.34126  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -215.851  12.1086  2.34126  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.851  12.1086  2.34126  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.366  12.1086  2.34126  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2417 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -283.716  12.1086  2.34126  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.604  12.1086  2.34126  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.959  11.9983  2.34678  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.959  11.9983  2.34678  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.256  11.9983  2.34678  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3051 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.251  11.9983  2.34678  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.686  11.9983  2.34678  0.154
protocols.relax.FastRelax: {0} CMD: min  -266.83  12.0273  2.32832  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -266.83  12.0273  2.32832  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.193  12.0273  2.32832  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2853 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.889  12.0273  2.32832  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.958  12.0273  2.32832  0.31955
protocols.relax.FastRelax: {0} CMD: min  -236.158  12.1041  2.31301  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.158  12.1041  2.31301  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.137  12.1041  2.31301  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2586 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.197  12.1041  2.31301  0.55
protocols.relax.FastRelax: {0} CMD: min  -219.154  12.1352  2.3854  0.55
protocols.relax.FastRelax: {0} MRP: 3  -219.154  -219.154  12.1352  2.3854
protocols.relax.FastRelax: {0} CMD: accept_to_best  -219.154  12.1352  2.3854  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -219.154  12.1352  2.3854  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -219.154  12.1352  2.3854  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.465  12.1352  2.3854  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2403 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -285.637  12.1352  2.3854  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.148  12.1352  2.3854  0.02805
protocols.relax.FastRelax: {0} CMD: min  -318.36  12.0153  2.36298  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -318.36  12.0153  2.36298  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.168  12.0153  2.36298  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2887 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.023  12.0153  2.36298  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.04  12.0153  2.36298  0.154
protocols.relax.FastRelax: {0} CMD: min  -273.606  12.0721  2.27932  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.606  12.0721  2.27932  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.946  12.0721  2.27932  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2653 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.057  12.0721  2.27932  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.179  12.0721  2.27932  0.31955
protocols.relax.FastRelax: {0} CMD: min  -240.7  12.1535  2.34005  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -240.7  12.1535  2.34005  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.01  12.1535  2.34005  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2524 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.169  12.1535  2.34005  0.55
protocols.relax.FastRelax: {0} CMD: min  -221.472  12.1246  2.37613  0.55
protocols.relax.FastRelax: {0} MRP: 4  -221.472  -221.472  12.1246  2.37613
protocols.relax.FastRelax: {0} CMD: accept_to_best  -221.472  12.1246  2.37613  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -221.472  12.1246  2.37613  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_49.pdb
protocols.relax.FastRelax: {0} CMD: repeat  75282.7  15.0259  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  75282.7  15.0259  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  8117.35  15.0259  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2941 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -81.4988  15.0259  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -57.4058  15.0259  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -209.996  14.6564  11.8867  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.996  14.6564  11.8867  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -72.4455  14.6564  11.8867  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2364 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -106.775  14.6564  11.8867  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -100.559  14.6564  11.8867  0.154
protocols.relax.FastRelax: {0} CMD: min  -188.117  14.0449  11.5536  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -188.117  14.0449  11.5536  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.83  14.0449  11.5536  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2093 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -156.401  14.0449  11.5536  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.781  14.0449  11.5536  0.31955
protocols.relax.FastRelax: {0} CMD: min  -161.513  14.4199  11.3939  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -161.513  14.4199  11.3939  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -124.861  14.4199  11.3939  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2062 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -125.075  14.4199  11.3939  0.55
protocols.relax.FastRelax: {0} CMD: min  -169.602  15.0579  13.741  0.55
protocols.relax.FastRelax: {0} MRP: 0  -169.602  -169.602  15.0579  13.741
protocols.relax.FastRelax: {0} CMD: accept_to_best  -169.602  15.0579  13.741  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -169.602  15.0579  13.741  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -169.602  15.0579  13.741  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.677  15.0579  13.741  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2215 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.661  15.0579  13.741  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.748  15.0579  13.741  0.02805
protocols.relax.FastRelax: {0} CMD: min  -272.232  14.2842  13.0526  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -272.232  14.2842  13.0526  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.392  14.2842  13.0526  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2248 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -189.678  14.2842  13.0526  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.51  14.2842  13.0526  0.154
protocols.relax.FastRelax: {0} CMD: min  -233.222  14.4855  12.9976  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -233.222  14.4855  12.9976  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.892  14.4855  12.9976  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2122 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.007  14.4855  12.9976  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.465  14.4855  12.9976  0.31955
protocols.relax.FastRelax: {0} CMD: min  -199.611  14.4705  12.9831  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -199.611  14.4705  12.9831  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.089  14.4705  12.9831  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2086 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -153.901  14.4705  12.9831  0.55
protocols.relax.FastRelax: {0} CMD: min  -193.503  14.3653  12.7825  0.55
protocols.relax.FastRelax: {0} MRP: 1  -193.503  -193.503  14.3653  12.7825
protocols.relax.FastRelax: {0} CMD: accept_to_best  -193.503  14.3653  12.7825  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -193.503  14.3653  12.7825  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.503  14.3653  12.7825  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.288  14.3653  12.7825  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2260 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -257.656  14.3653  12.7825  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.688  14.3653  12.7825  0.02805
protocols.relax.FastRelax: {0} CMD: min  -284.899  13.943  14.0254  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.899  13.943  14.0254  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.417  13.943  14.0254  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2223 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.435  13.943  14.0254  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.396  13.943  14.0254  0.154
protocols.relax.FastRelax: {0} CMD: min  -244.9  13.8843  13.1151  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.9  13.8843  13.1151  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.496  13.8843  13.1151  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2160 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.606  13.8843  13.1151  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.061  13.8843  13.1151  0.31955
protocols.relax.FastRelax: {0} CMD: min  -212.912  13.8673  13.1507  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.912  13.8673  13.1507  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.385  13.8673  13.1507  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2070 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -169.906  13.8673  13.1507  0.55
protocols.relax.FastRelax: {0} CMD: min  -196.069  13.9456  12.5508  0.55
protocols.relax.FastRelax: {0} MRP: 2  -196.069  -196.069  13.9456  12.5508
protocols.relax.FastRelax: {0} CMD: accept_to_best  -196.069  13.9456  12.5508  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -196.069  13.9456  12.5508  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.069  13.9456  12.5508  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.973  13.9456  12.5508  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2339 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.324  13.9456  12.5508  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.727  13.9456  12.5508  0.02805
protocols.relax.FastRelax: {0} CMD: min  -263.937  14.0204  12.6992  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -263.937  14.0204  12.6992  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.732  14.0204  12.6992  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2151 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.001  14.0204  12.6992  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.308  14.0204  12.6992  0.154
protocols.relax.FastRelax: {0} CMD: min  -236.195  13.9813  12.8978  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.195  13.9813  12.8978  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.396  13.9813  12.8978  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2274 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.675  13.9813  12.8978  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.634  13.9813  12.8978  0.31955
protocols.relax.FastRelax: {0} CMD: min  -216.602  13.818  12.7717  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.602  13.818  12.7717  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.603  13.818  12.7717  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2228 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.338  13.818  12.7717  0.55
protocols.relax.FastRelax: {0} CMD: min  -196.658  13.894  12.3009  0.55
protocols.relax.FastRelax: {0} MRP: 3  -196.658  -196.658  13.894  12.3009
protocols.relax.FastRelax: {0} CMD: accept_to_best  -196.658  13.894  12.3009  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -196.658  13.894  12.3009  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.658  13.894  12.3009  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.376  13.894  12.3009  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2346 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.522  13.894  12.3009  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.633  13.894  12.3009  0.02805
protocols.relax.FastRelax: {0} CMD: min  -263.494  13.9332  12.3347  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -263.494  13.9332  12.3347  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.462  13.9332  12.3347  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2243 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.688  13.9332  12.3347  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.197  13.9332  12.3347  0.154
protocols.relax.FastRelax: {0} CMD: min  -241.634  13.8448  12.55  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.634  13.8448  12.55  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.039  13.8448  12.55  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2290 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.245  13.8448  12.55  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.372  13.8448  12.55  0.31955
protocols.relax.FastRelax: {0} CMD: min  -217.448  13.8271  12.5563  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.448  13.8271  12.5563  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.329  13.8271  12.5563  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2236 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.386  13.8271  12.5563  0.55
protocols.relax.FastRelax: {0} CMD: min  -196.601  13.8877  12.284  0.55
protocols.relax.FastRelax: {0} MRP: 4  -196.601  -196.658  13.894  12.3009
protocols.relax.FastRelax: {0} CMD: accept_to_best  -196.601  13.8877  12.284  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -196.601  13.8877  12.284  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_11.pdb
protocols.relax.FastRelax: {0} CMD: repeat  73346.9  16.4806  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  73346.9  16.4806  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7981.01  16.4806  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2175 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  143.607  16.4806  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  160.325  16.4806  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -207.787  17.033  4.94463  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -207.787  17.033  4.94463  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  37.3953  17.033  4.94463  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2301 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -133.01  17.033  4.94463  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -126.046  17.033  4.94463  0.154
protocols.relax.FastRelax: {0} CMD: min  -187.055  17.562  5.47868  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -187.055  17.562  5.47868  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -129.808  17.562  5.47868  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2397 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -132.124  17.562  5.47868  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -127.641  17.562  5.47868  0.31955
protocols.relax.FastRelax: {0} CMD: min  -168.366  17.6438  6.07028  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -168.366  17.6438  6.07028  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -117.956  17.6438  6.07028  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2507 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -118.99  17.6438  6.07028  0.55
protocols.relax.FastRelax: {0} CMD: min  -181.948  17.9826  6.79485  0.55
protocols.relax.FastRelax: {0} MRP: 0  -181.948  -181.948  17.9826  6.79485
protocols.relax.FastRelax: {0} CMD: accept_to_best  -181.948  17.9826  6.79485  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -181.948  17.9826  6.79485  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -181.948  17.9826  6.79485  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.851  17.9826  6.79485  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2788 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -270.903  17.9826  6.79485  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -268.292  17.9826  6.79485  0.02805
protocols.relax.FastRelax: {0} CMD: min  -312.204  17.3175  6.69639  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -312.204  17.3175  6.69639  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.947  17.3175  6.69639  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2873 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.168  17.3175  6.69639  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.408  17.3175  6.69639  0.154
protocols.relax.FastRelax: {0} CMD: min  -242.06  17.4446  7.00574  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.06  17.4446  7.00574  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.142  17.4446  7.00574  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2605 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.606  17.4446  7.00574  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.161  17.4446  7.00574  0.31955
protocols.relax.FastRelax: {0} CMD: min  -214.592  17.7047  7.07693  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -214.592  17.7047  7.07693  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.167  17.7047  7.07693  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2499 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.37  17.7047  7.07693  0.55
protocols.relax.FastRelax: {0} CMD: min  -199.573  17.6321  7.24533  0.55
protocols.relax.FastRelax: {0} MRP: 1  -199.573  -199.573  17.6321  7.24533
protocols.relax.FastRelax: {0} CMD: accept_to_best  -199.573  17.6321  7.24533  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -199.573  17.6321  7.24533  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -199.573  17.6321  7.24533  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.097  17.6321  7.24533  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2837 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -277.844  17.6321  7.24533  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.127  17.6321  7.24533  0.02805
protocols.relax.FastRelax: {0} CMD: min  -315.672  17.3432  6.94065  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -315.672  17.3432  6.94065  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.274  17.3432  6.94065  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2963 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.1  17.3432  6.94065  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.892  17.3432  6.94065  0.154
protocols.relax.FastRelax: {0} CMD: min  -261.546  17.5052  7.11678  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.546  17.5052  7.11678  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.839  17.5052  7.11678  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2630 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.055  17.5052  7.11678  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.806  17.5052  7.11678  0.31955
protocols.relax.FastRelax: {0} CMD: min  -227.377  17.5063  7.23779  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -227.377  17.5063  7.23779  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.057  17.5063  7.23779  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2444 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -181.247  17.5063  7.23779  0.55
protocols.relax.FastRelax: {0} CMD: min  -202.623  17.6443  7.28178  0.55
protocols.relax.FastRelax: {0} MRP: 2  -202.623  -202.623  17.6443  7.28178
protocols.relax.FastRelax: {0} CMD: accept_to_best  -202.623  17.6443  7.28178  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -202.623  17.6443  7.28178  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.623  17.6443  7.28178  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.398  17.6443  7.28178  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3115 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -278.706  17.6443  7.28178  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.303  17.6443  7.28178  0.02805
protocols.relax.FastRelax: {0} CMD: min  -301.807  17.4903  7.12153  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -301.807  17.4903  7.12153  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.766  17.4903  7.12153  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2665 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.575  17.4903  7.12153  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.655  17.4903  7.12153  0.154
protocols.relax.FastRelax: {0} CMD: min  -262.76  17.565  7.01603  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.76  17.565  7.01603  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.066  17.565  7.01603  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2665 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.249  17.565  7.01603  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.434  17.565  7.01603  0.31955
protocols.relax.FastRelax: {0} CMD: min  -230.418  17.565  7.20016  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.418  17.565  7.20016  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.919  17.565  7.20016  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2640 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -188.937  17.565  7.20016  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.858  17.6924  7.33172  0.55
protocols.relax.FastRelax: {0} MRP: 3  -204.858  -204.858  17.6924  7.33172
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.858  17.6924  7.33172  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.858  17.6924  7.33172  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.858  17.6924  7.33172  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.839  17.6924  7.33172  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2783 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -278.14  17.6924  7.33172  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.823  17.6924  7.33172  0.02805
protocols.relax.FastRelax: {0} CMD: min  -307.869  17.5536  7.05819  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -307.869  17.5536  7.05819  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.567  17.5536  7.05819  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2871 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.415  17.5536  7.05819  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.655  17.5536  7.05819  0.154
protocols.relax.FastRelax: {0} CMD: min  -256.335  17.691  6.92665  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.335  17.691  6.92665  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.87  17.691  6.92665  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2711 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.636  17.691  6.92665  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.883  17.691  6.92665  0.31955
protocols.relax.FastRelax: {0} CMD: min  -228.653  17.8121  6.85873  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.653  17.8121  6.85873  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.679  17.8121  6.85873  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2556 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.172  17.8121  6.85873  0.55
protocols.relax.FastRelax: {0} CMD: min  -205.997  17.931  6.72635  0.55
protocols.relax.FastRelax: {0} MRP: 4  -205.997  -205.997  17.931  6.72635
protocols.relax.FastRelax: {0} CMD: accept_to_best  -205.997  17.931  6.72635  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -205.997  17.931  6.72635  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_2.pdb
protocols.relax.FastRelax: {0} CMD: repeat  74712.5  15.0136  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  74712.5  15.0136  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  8348.16  15.0136  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2423 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  133.61  15.0136  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  164.614  15.0136  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -272.302  15.2268  1.96935  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -272.302  15.2268  1.96935  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -149.603  15.2268  1.96935  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2500 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.924  15.2268  1.96935  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.12  15.2268  1.96935  0.154
protocols.relax.FastRelax: {0} CMD: min  -239.541  15.356  2.39412  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.541  15.356  2.39412  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.11  15.356  2.39412  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2320 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.231  15.356  2.39412  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.927  15.356  2.39412  0.31955
protocols.relax.FastRelax: {0} CMD: min  -205.83  15.3797  2.37168  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.83  15.3797  2.37168  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -161.089  15.3797  2.37168  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2317 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.374  15.3797  2.37168  0.55
protocols.relax.FastRelax: {0} CMD: min  -190.726  15.5048  2.91421  0.55
protocols.relax.FastRelax: {0} MRP: 0  -190.726  -190.726  15.5048  2.91421
protocols.relax.FastRelax: {0} CMD: accept_to_best  -190.726  15.5048  2.91421  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -190.726  15.5048  2.91421  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -190.726  15.5048  2.91421  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.321  15.5048  2.91421  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2366 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.121  15.5048  2.91421  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.931  15.5048  2.91421  0.02805
protocols.relax.FastRelax: {0} CMD: min  -325.828  15.5097  3.36862  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -325.828  15.5097  3.36862  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.185  15.5097  3.36862  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2764 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.048  15.5097  3.36862  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.1  15.5097  3.36862  0.154
protocols.relax.FastRelax: {0} CMD: min  -264.974  15.4792  3.31238  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -264.974  15.4792  3.31238  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.57  15.4792  3.31238  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2614 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.627  15.4792  3.31238  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.136  15.4792  3.31238  0.31955
protocols.relax.FastRelax: {0} CMD: min  -233.763  15.4792  3.33566  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -233.763  15.4792  3.33566  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.707  15.4792  3.33566  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2533 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.999  15.4792  3.33566  0.55
protocols.relax.FastRelax: {0} CMD: min  -220.057  15.4941  3.43341  0.55
protocols.relax.FastRelax: {0} MRP: 1  -220.057  -220.057  15.4941  3.43341
protocols.relax.FastRelax: {0} CMD: accept_to_best  -220.057  15.4941  3.43341  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -220.057  15.4941  3.43341  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.057  15.4941  3.43341  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.146  15.4941  3.43341  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2861 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -298.282  15.4941  3.43341  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -295.98  15.4941  3.43341  0.02805
protocols.relax.FastRelax: {0} CMD: min  -356.746  15.6517  3.78638  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -356.746  15.6517  3.78638  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.299  15.6517  3.78638  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3026 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.41  15.6517  3.78638  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.161  15.6517  3.78638  0.154
protocols.relax.FastRelax: {0} CMD: min  -292.106  15.5335  3.78315  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -292.106  15.5335  3.78315  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.45  15.5335  3.78315  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2934 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -247.067  15.5335  3.78315  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.501  15.5335  3.78315  0.31955
protocols.relax.FastRelax: {0} CMD: min  -257.33  15.5395  3.67113  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.33  15.5395  3.67113  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.535  15.5395  3.67113  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2544 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.77  15.5395  3.67113  0.55
protocols.relax.FastRelax: {0} CMD: min  -231.573  15.5598  3.63928  0.55
protocols.relax.FastRelax: {0} MRP: 2  -231.573  -231.573  15.5598  3.63928
protocols.relax.FastRelax: {0} CMD: accept_to_best  -231.573  15.5598  3.63928  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -231.573  15.5598  3.63928  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.573  15.5598  3.63928  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -301.79  15.5598  3.63928  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2910 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -311.808  15.5598  3.63928  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -309.732  15.5598  3.63928  0.02805
protocols.relax.FastRelax: {0} CMD: min  -352.567  15.5931  3.83159  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -352.567  15.5931  3.83159  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.838  15.5931  3.83159  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2975 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.585  15.5931  3.83159  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.888  15.5931  3.83159  0.154
protocols.relax.FastRelax: {0} CMD: min  -294.068  15.62  3.79597  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -294.068  15.62  3.79597  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.683  15.62  3.79597  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2938 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.832  15.62  3.79597  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.48  15.62  3.79597  0.31955
protocols.relax.FastRelax: {0} CMD: min  -260.369  15.6109  3.76663  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.369  15.6109  3.76663  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.405  15.6109  3.76663  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2555 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.424  15.6109  3.76663  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.869  15.6297  3.72444  0.55
protocols.relax.FastRelax: {0} MRP: 3  -230.869  -231.573  15.5598  3.63928
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.869  15.6297  3.72444  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.869  15.6297  3.72444  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.869  15.6297  3.72444  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -301.906  15.6297  3.72444  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2798 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -316.646  15.6297  3.72444  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -314.273  15.6297  3.72444  0.02805
protocols.relax.FastRelax: {0} CMD: min  -366.917  15.6313  4.03113  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -366.917  15.6313  4.03113  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.231  15.6313  4.03113  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2876 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.104  15.6313  4.03113  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.258  15.6313  4.03113  0.154
protocols.relax.FastRelax: {0} CMD: min  -297.136  15.6221  3.95938  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -297.136  15.6221  3.95938  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.639  15.6221  3.95938  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2720 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -249.508  15.6221  3.95938  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.683  15.6221  3.95938  0.31955
protocols.relax.FastRelax: {0} CMD: min  -258.884  15.6608  3.88717  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.884  15.6608  3.88717  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.949  15.6608  3.88717  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2494 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.186  15.6608  3.88717  0.55
protocols.relax.FastRelax: {0} CMD: min  -229.653  15.7167  3.81735  0.55
protocols.relax.FastRelax: {0} MRP: 4  -229.653  -231.573  15.5598  3.63928
protocols.relax.FastRelax: {0} CMD: accept_to_best  -229.653  15.7167  3.81735  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -229.653  15.7167  3.81735  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_7.pdb
protocols.relax.FastRelax: {0} CMD: repeat  68868.1  13.4014  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  68868.1  13.4014  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7743.42  13.4014  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2403 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  137.527  13.4014  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  170.605  13.4014  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -264.215  13.1023  3.52553  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -264.215  13.1023  3.52553  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -109.435  13.1023  3.52553  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2647 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -133.144  13.1023  3.52553  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -124.615  13.1023  3.52553  0.154
protocols.relax.FastRelax: {0} CMD: min  -208.43  13.2983  3.70611  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.43  13.2983  3.70611  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.329  13.2983  3.70611  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2408 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.245  13.2983  3.70611  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -157.451  13.2983  3.70611  0.31955
protocols.relax.FastRelax: {0} CMD: min  -169.983  13.4843  3.73856  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -169.983  13.4843  3.73856  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -116.158  13.4843  3.73856  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2240 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -116.874  13.4843  3.73856  0.55
protocols.relax.FastRelax: {0} CMD: min  -182.338  13.0507  5.09265  0.55
protocols.relax.FastRelax: {0} MRP: 0  -182.338  -182.338  13.0507  5.09265
protocols.relax.FastRelax: {0} CMD: accept_to_best  -182.338  13.0507  5.09265  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -182.338  13.0507  5.09265  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -182.338  13.0507  5.09265  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.667  13.0507  5.09265  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2376 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.236  13.0507  5.09265  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.072  13.0507  5.09265  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.068  12.72  5.23135  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.068  12.72  5.23135  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.219  12.72  5.23135  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2644 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.178  12.72  5.23135  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.546  12.72  5.23135  0.154
protocols.relax.FastRelax: {0} CMD: min  -258.195  12.8568  5.1998  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.195  12.8568  5.1998  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.034  12.8568  5.1998  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2323 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.707  12.8568  5.1998  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.041  12.8568  5.1998  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.3  12.9432  5.35149  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.3  12.9432  5.35149  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.375  12.9432  5.35149  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2317 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.821  12.9432  5.35149  0.55
protocols.relax.FastRelax: {0} CMD: min  -205.007  12.7803  4.93281  0.55
protocols.relax.FastRelax: {0} MRP: 1  -205.007  -205.007  12.7803  4.93281
protocols.relax.FastRelax: {0} CMD: accept_to_best  -205.007  12.7803  4.93281  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -205.007  12.7803  4.93281  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.007  12.7803  4.93281  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.541  12.7803  4.93281  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2592 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -281.758  12.7803  4.93281  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.073  12.7803  4.93281  0.02805
protocols.relax.FastRelax: {0} CMD: min  -336.456  12.3825  5.45872  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -336.456  12.3825  5.45872  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.621  12.3825  5.45872  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2936 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.719  12.3825  5.45872  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.333  12.3825  5.45872  0.154
protocols.relax.FastRelax: {0} CMD: min  -267.851  12.4515  5.32153  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.851  12.4515  5.32153  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.853  12.4515  5.32153  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2820 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.59  12.4515  5.32153  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.746  12.4515  5.32153  0.31955
protocols.relax.FastRelax: {0} CMD: min  -228.954  12.5656  5.24925  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.954  12.5656  5.24925  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.31  12.5656  5.24925  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2574 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.335  12.5656  5.24925  0.55
protocols.relax.FastRelax: {0} CMD: min  -213.877  12.6286  5.12478  0.55
protocols.relax.FastRelax: {0} MRP: 2  -213.877  -213.877  12.6286  5.12478
protocols.relax.FastRelax: {0} CMD: accept_to_best  -213.877  12.6286  5.12478  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -213.877  12.6286  5.12478  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.877  12.6286  5.12478  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.899  12.6286  5.12478  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2886 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -296.128  12.6286  5.12478  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.082  12.6286  5.12478  0.02805
protocols.relax.FastRelax: {0} CMD: min  -341.515  12.2671  5.42612  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -341.515  12.2671  5.42612  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.481  12.2671  5.42612  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3130 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.95  12.2671  5.42612  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.582  12.2671  5.42612  0.154
protocols.relax.FastRelax: {0} CMD: min  -271.513  12.369  5.26399  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.513  12.369  5.26399  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.748  12.369  5.26399  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2742 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.645  12.369  5.26399  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.653  12.369  5.26399  0.31955
protocols.relax.FastRelax: {0} CMD: min  -231.006  12.4465  5.13734  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.006  12.4465  5.13734  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.135  12.4465  5.13734  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2497 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.654  12.4465  5.13734  0.55
protocols.relax.FastRelax: {0} CMD: min  -213.067  12.4064  5.12824  0.55
protocols.relax.FastRelax: {0} MRP: 3  -213.067  -213.877  12.6286  5.12478
protocols.relax.FastRelax: {0} CMD: accept_to_best  -213.067  12.4064  5.12824  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -213.067  12.4064  5.12824  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.067  12.4064  5.12824  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.15  12.4064  5.12824  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2963 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -299.816  12.4064  5.12824  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -297.328  12.4064  5.12824  0.02805
protocols.relax.FastRelax: {0} CMD: min  -352.594  12.1814  5.37591  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -352.594  12.1814  5.37591  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.946  12.1814  5.37591  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3054 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.742  12.1814  5.37591  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.15  12.1814  5.37591  0.154
protocols.relax.FastRelax: {0} CMD: min  -284.571  12.3366  5.22853  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.571  12.3366  5.22853  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.364  12.3366  5.22853  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2796 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.762  12.3366  5.22853  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.523  12.3366  5.22853  0.31955
protocols.relax.FastRelax: {0} CMD: min  -243.186  12.3832  5.15458  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.186  12.3832  5.15458  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.968  12.3832  5.15458  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2526 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.372  12.3832  5.15458  0.55
protocols.relax.FastRelax: {0} CMD: min  -216.098  12.2947  5.27215  0.55
protocols.relax.FastRelax: {0} MRP: 4  -216.098  -216.098  12.2947  5.27215
protocols.relax.FastRelax: {0} CMD: accept_to_best  -216.098  12.2947  5.27215  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -216.098  12.2947  5.27215  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_32.pdb
protocols.relax.FastRelax: {0} CMD: repeat  68324.3  20.6672  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  68324.3  20.6672  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7024.95  20.6672  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3281 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  165.153  20.6672  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  187.64  20.6672  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -235.324  18.9946  4.46959  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.324  18.9946  4.46959  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -124.845  18.9946  4.46959  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2935 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -147.307  18.9946  4.46959  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.875  18.9946  4.46959  0.154
protocols.relax.FastRelax: {0} CMD: min  -205.578  19.2658  4.35587  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.578  19.2658  4.35587  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.979  19.2658  4.35587  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2696 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -167.242  19.2658  4.35587  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.081  19.2658  4.35587  0.31955
protocols.relax.FastRelax: {0} CMD: min  -170.088  19.3694  4.28323  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -170.088  19.3694  4.28323  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -120.852  19.3694  4.28323  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2627 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -121.056  19.3694  4.28323  0.55
protocols.relax.FastRelax: {0} CMD: min  -169.051  19.4565  4.15208  0.55
protocols.relax.FastRelax: {0} MRP: 0  -169.051  -169.051  19.4565  4.15208
protocols.relax.FastRelax: {0} CMD: accept_to_best  -169.051  19.4565  4.15208  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -169.051  19.4565  4.15208  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -169.051  19.4565  4.15208  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.022  19.4565  4.15208  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2789 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.107  19.4565  4.15208  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.623  19.4565  4.15208  0.02805
protocols.relax.FastRelax: {0} CMD: min  -278.969  19.1485  4.24815  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -278.969  19.1485  4.24815  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.604  19.1485  4.24815  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3116 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -190.629  19.1485  4.24815  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.195  19.1485  4.24815  0.154
protocols.relax.FastRelax: {0} CMD: min  -222.954  19.3039  4.18473  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.954  19.3039  4.18473  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.188  19.3039  4.18473  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2888 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -182.647  19.3039  4.18473  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.532  19.3039  4.18473  0.31955
protocols.relax.FastRelax: {0} CMD: min  -193.162  19.4236  3.91077  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.162  19.4236  3.91077  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -151.951  19.4236  3.91077  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2732 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -152.282  19.4236  3.91077  0.55
protocols.relax.FastRelax: {0} CMD: min  -180.381  19.8475  3.83995  0.55
protocols.relax.FastRelax: {0} MRP: 1  -180.381  -180.381  19.8475  3.83995
protocols.relax.FastRelax: {0} CMD: accept_to_best  -180.381  19.8475  3.83995  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -180.381  19.8475  3.83995  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -180.381  19.8475  3.83995  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.944  19.8475  3.83995  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3311 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.123  19.8475  3.83995  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.865  19.8475  3.83995  0.02805
protocols.relax.FastRelax: {0} CMD: min  -302.006  19.4668  3.88727  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -302.006  19.4668  3.88727  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.562  19.4668  3.88727  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3529 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.176  19.4668  3.88727  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.298  19.4668  3.88727  0.154
protocols.relax.FastRelax: {0} CMD: min  -241.468  19.6592  3.88479  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.468  19.6592  3.88479  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.288  19.6592  3.88479  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3143 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.684  19.6592  3.88479  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.362  19.6592  3.88479  0.31955
protocols.relax.FastRelax: {0} CMD: min  -207.785  19.7949  3.84411  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -207.785  19.7949  3.84411  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -165.403  19.7949  3.84411  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2958 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -165.715  19.7949  3.84411  0.55
protocols.relax.FastRelax: {0} CMD: min  -186.367  19.7694  4.049  0.55
protocols.relax.FastRelax: {0} MRP: 2  -186.367  -186.367  19.7694  4.049
protocols.relax.FastRelax: {0} CMD: accept_to_best  -186.367  19.7694  4.049  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -186.367  19.7694  4.049  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -186.367  19.7694  4.049  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.627  19.7694  4.049  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3252 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -258.064  19.7694  4.049  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.642  19.7694  4.049  0.02805
protocols.relax.FastRelax: {0} CMD: min  -302.763  19.4143  4.15441  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -302.763  19.4143  4.15441  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.39  19.4143  4.15441  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3517 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.607  19.4143  4.15441  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.723  19.4143  4.15441  0.154
protocols.relax.FastRelax: {0} CMD: min  -248.953  19.5408  4.15406  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.953  19.5408  4.15406  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.641  19.5408  4.15406  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3032 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.431  19.5408  4.15406  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.029  19.5408  4.15406  0.31955
protocols.relax.FastRelax: {0} CMD: min  -212.409  19.672  4.11506  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.409  19.672  4.11506  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.491  19.672  4.11506  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2904 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -170.011  19.672  4.11506  0.55
protocols.relax.FastRelax: {0} CMD: min  -189.323  19.7269  4.03699  0.55
protocols.relax.FastRelax: {0} MRP: 3  -189.323  -189.323  19.7269  4.03699
protocols.relax.FastRelax: {0} CMD: accept_to_best  -189.323  19.7269  4.03699  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -189.323  19.7269  4.03699  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -189.323  19.7269  4.03699  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.431  19.7269  4.03699  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3259 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.192  19.7269  4.03699  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.913  19.7269  4.03699  0.02805
protocols.relax.FastRelax: {0} CMD: min  -305.67  19.4504  4.14056  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -305.67  19.4504  4.14056  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.346  19.4504  4.14056  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3635 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.707  19.4504  4.14056  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.892  19.4504  4.14056  0.154
protocols.relax.FastRelax: {0} CMD: min  -249.668  19.5216  4.12446  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.668  19.5216  4.12446  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.163  19.5216  4.12446  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3086 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.904  19.5216  4.12446  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.442  19.5216  4.12446  0.31955
protocols.relax.FastRelax: {0} CMD: min  -215.462  19.6537  4.05836  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.462  19.6537  4.05836  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.261  19.6537  4.05836  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2977 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.484  19.6537  4.05836  0.55
protocols.relax.FastRelax: {0} CMD: min  -189.803  19.7602  4.05611  0.55
protocols.relax.FastRelax: {0} MRP: 4  -189.803  -189.803  19.7602  4.05611
protocols.relax.FastRelax: {0} CMD: accept_to_best  -189.803  19.7602  4.05611  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -189.803  19.7602  4.05611  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_6.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71522.3  12.5232  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71522.3  12.5232  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6851.49  12.5232  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3148 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -86.8724  12.5232  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -50.1323  12.5232  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -303.789  12.6968  2.89161  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -303.789  12.6968  2.89161  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -130.189  12.6968  2.89161  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3267 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.392  12.6968  2.89161  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -152.087  12.6968  2.89161  0.154
protocols.relax.FastRelax: {0} CMD: min  -236.134  12.7472  2.53446  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.134  12.7472  2.53446  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.996  12.7472  2.53446  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2913 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.971  12.7472  2.53446  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.58  12.7472  2.53446  0.31955
protocols.relax.FastRelax: {0} CMD: min  -206.673  12.6021  2.49605  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -206.673  12.6021  2.49605  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.524  12.6021  2.49605  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2951 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -159.918  12.6021  2.49605  0.55
protocols.relax.FastRelax: {0} CMD: min  -208.683  12.6402  2.76013  0.55
protocols.relax.FastRelax: {0} MRP: 0  -208.683  -208.683  12.6402  2.76013
protocols.relax.FastRelax: {0} CMD: accept_to_best  -208.683  12.6402  2.76013  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -208.683  12.6402  2.76013  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.683  12.6402  2.76013  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.236  12.6402  2.76013  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3148 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -300.979  12.6402  2.76013  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -296.399  12.6402  2.76013  0.02805
protocols.relax.FastRelax: {0} CMD: min  -334.686  12.4514  2.72608  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -334.686  12.4514  2.72608  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -165.389  12.4514  2.72608  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3118 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.884  12.4514  2.72608  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.317  12.4514  2.72608  0.154
protocols.relax.FastRelax: {0} CMD: min  -274.464  12.5848  2.71963  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.464  12.5848  2.71963  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.597  12.5848  2.71963  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3014 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.575  12.5848  2.71963  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.108  12.5848  2.71963  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.239  12.6081  2.66602  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.239  12.6081  2.66602  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.503  12.6081  2.66602  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2857 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.616  12.6081  2.66602  0.55
protocols.relax.FastRelax: {0} CMD: min  -227.673  12.58  2.89442  0.55
protocols.relax.FastRelax: {0} MRP: 1  -227.673  -227.673  12.58  2.89442
protocols.relax.FastRelax: {0} CMD: accept_to_best  -227.673  12.58  2.89442  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -227.673  12.58  2.89442  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -227.673  12.58  2.89442  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -299.022  12.58  2.89442  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3281 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -307.23  12.58  2.89442  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -305.017  12.58  2.89442  0.02805
protocols.relax.FastRelax: {0} CMD: min  -355.063  12.47  2.83762  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -355.063  12.47  2.83762  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.271  12.47  2.83762  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3286 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.969  12.47  2.83762  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.852  12.47  2.83762  0.154
protocols.relax.FastRelax: {0} CMD: min  -290.556  12.6168  2.87857  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -290.556  12.6168  2.87857  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.531  12.6168  2.87857  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3042 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -246.254  12.6168  2.87857  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.911  12.6168  2.87857  0.31955
protocols.relax.FastRelax: {0} CMD: min  -255.347  12.5729  2.82953  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.347  12.5729  2.82953  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.013  12.5729  2.82953  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2848 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.079  12.5729  2.82953  0.55
protocols.relax.FastRelax: {0} CMD: min  -229.765  12.4437  2.89013  0.55
protocols.relax.FastRelax: {0} MRP: 2  -229.765  -229.765  12.4437  2.89013
protocols.relax.FastRelax: {0} CMD: accept_to_best  -229.765  12.4437  2.89013  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -229.765  12.4437  2.89013  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.765  12.4437  2.89013  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -300.487  12.4437  2.89013  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3293 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -310.07  12.4437  2.89013  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -307.418  12.4437  2.89013  0.02805
protocols.relax.FastRelax: {0} CMD: min  -351.944  12.4468  2.72866  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -351.944  12.4468  2.72866  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.344  12.4468  2.72866  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3132 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.779  12.4468  2.72866  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.49  12.4468  2.72866  0.154
protocols.relax.FastRelax: {0} CMD: min  -292.733  12.4815  2.72168  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -292.733  12.4815  2.72168  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.589  12.4815  2.72168  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2971 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.962  12.4815  2.72168  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.521  12.4815  2.72168  0.31955
protocols.relax.FastRelax: {0} CMD: min  -257.57  12.4457  2.72833  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.57  12.4457  2.72833  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.317  12.4457  2.72833  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2813 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.4  12.4457  2.72833  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.114  12.4413  2.88796  0.55
protocols.relax.FastRelax: {0} MRP: 3  -230.114  -230.114  12.4413  2.88796
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.114  12.4413  2.88796  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.114  12.4413  2.88796  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.114  12.4413  2.88796  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -301.37  12.4413  2.88796  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3298 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -311.105  12.4413  2.88796  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -308.509  12.4413  2.88796  0.02805
protocols.relax.FastRelax: {0} CMD: min  -350.093  12.4908  2.93367  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -350.093  12.4908  2.93367  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.359  12.4908  2.93367  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3077 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -258.229  12.4908  2.93367  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.545  12.4908  2.93367  0.154
protocols.relax.FastRelax: {0} CMD: min  -295.676  12.4853  2.80897  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -295.676  12.4853  2.80897  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.709  12.4853  2.80897  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3059 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -253.114  12.4853  2.80897  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.709  12.4853  2.80897  0.31955
protocols.relax.FastRelax: {0} CMD: min  -259.891  12.4941  2.89314  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.891  12.4941  2.89314  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.531  12.4941  2.89314  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2855 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.713  12.4941  2.89314  0.55
protocols.relax.FastRelax: {0} CMD: min  -232.551  12.4352  2.9043  0.55
protocols.relax.FastRelax: {0} MRP: 4  -232.551  -232.551  12.4352  2.9043
protocols.relax.FastRelax: {0} CMD: accept_to_best  -232.551  12.4352  2.9043  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -232.551  12.4352  2.9043  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax

Evaluating the folding results by getting the energies and RMSDs (distnace from the native pose) of each one of the predicted structures

In [104]:
decoy_poses = [prs.pose_from_pdb(f) for f in glob.glob(job_output + '*.pdb')]

core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_0.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_1.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_10.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_11.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_12.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_13.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_14.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_15.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_16.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_17.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_18.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_19.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_2.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_20.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_21.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_22.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_23.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_24.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_25.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_26.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_27.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_28.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_29.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_3.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_30.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_31.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_32.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_33.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_34.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_35.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_36.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_37.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_38.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_39.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_4.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_40.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_41.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_42.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_43.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_44.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_45.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_46.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_47.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_48.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_49.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_5.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_6.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_7.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_8.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_9.pdb' automatically determined to be of type PDB
In [105]:
def align_and_get_rmsds(native_pose, decoy_poses):
    prs.rosetta.core.pose.full_model_info.make_sure_full_model_info_is_setup(native_pose)
    rmsds = []
    for p in decoy_poses:
        prs.rosetta.core.pose.full_model_info.make_sure_full_model_info_is_setup(p)
        rmsds += [prs.rosetta.protocols.stepwise.modeler.align.superimpose_with_stepwise_aligner(native_pose, p)]
    return rmsds
In [106]:
rmsds = align_and_get_rmsds(native_pose, decoy_poses)

protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.9009015)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.4987369)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 15.3567333)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 11.6047392)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 15.1147466)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.3806944)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.2380818)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.8286593)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.8926384)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 19.3189983)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 18.2100391)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.1076267)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 15.1192950)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.4400439)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.4455337)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.3885305)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.7695996)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 7.1083967)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.5875410)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 9.0459136)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.1855458)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.7896746)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 11.8397376)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.8243025)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 11.5917909)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 9.9678502)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 16.5860146)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.2346184)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 16.0207556)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.2591144)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 15.2571634)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 17.1045510)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 9.7389675)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.4505402)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.2733449)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.9400718)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.5102476)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 11.1287605)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 10.5429207)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 15.6825368)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 8.3257396)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 10.5407520)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 11.7973567)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.1284100)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 19.3708676)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.3693016)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 9.6631569)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 10.6824030)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.6983023)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.4188914)
In [107]:
rmsd_data = []
for i in range(1, len(decoy_poses)):  # print out the job scores
    rmsd_data.append({'structure': decoy_poses[i].pdb_info().name(), 
                      'rmsd': rmsds[i],
                      'energy_score': scores[i]})
In [108]:
rmsd_df = pd.DataFrame(rmsd_data)
In [109]:
rmsd_df.sort_values('rmsd')
Out[109]:
energy_score rmsd structure
16 -197.959971 7.108397 outputs/1BL0/decoy_24.pdb
39 -228.372367 8.325740 outputs/1BL0/decoy_45.pdb
18 -234.621740 9.045914 outputs/1BL0/decoy_26.pdb
45 -205.997357 9.663157 outputs/1BL0/decoy_6.pdb
31 -233.858734 9.738967 outputs/1BL0/decoy_38.pdb
24 -231.389186 9.967850 outputs/1BL0/decoy_31.pdb
40 -204.955972 10.540752 outputs/1BL0/decoy_46.pdb
37 -244.057888 10.542921 outputs/1BL0/decoy_43.pdb
46 -231.572555 10.682403 outputs/1BL0/decoy_7.pdb
36 -239.516895 11.128760 outputs/1BL0/decoy_42.pdb
23 -231.777327 11.591791 outputs/1BL0/decoy_30.pdb
2 -259.659288 11.604739 outputs/1BL0/decoy_11.pdb
41 -223.293790 11.797357 outputs/1BL0/decoy_47.pdb
21 -253.411118 11.839738 outputs/1BL0/decoy_29.pdb
10 -191.643084 12.107627 outputs/1BL0/decoy_19.pdb
28 -227.329056 12.259114 outputs/1BL0/decoy_35.pdb
13 -204.359433 12.445534 outputs/1BL0/decoy_21.pdb
0 -207.978678 12.498737 outputs/1BL0/decoy_1.pdb
35 -201.831105 12.510248 outputs/1BL0/decoy_41.pdb
7 -212.311276 12.892638 outputs/1BL0/decoy_16.pdb
42 -213.529761 13.128410 outputs/1BL0/decoy_48.pdb
5 -239.452001 13.238082 outputs/1BL0/decoy_14.pdb
44 -196.657864 13.369302 outputs/1BL0/decoy_5.pdb
4 -195.165055 13.380694 outputs/1BL0/decoy_13.pdb
14 -218.840428 13.388531 outputs/1BL0/decoy_22.pdb
48 -189.803202 13.418891 outputs/1BL0/decoy_9.pdb
17 -201.646003 13.587541 outputs/1BL0/decoy_25.pdb
34 -244.721162 13.940072 outputs/1BL0/decoy_40.pdb
19 -243.780022 14.185546 outputs/1BL0/decoy_27.pdb
26 -194.706906 14.234618 outputs/1BL0/decoy_33.pdb
33 -231.490636 14.273345 outputs/1BL0/decoy_4.pdb
12 -224.851910 14.440044 outputs/1BL0/decoy_20.pdb
32 -206.976630 14.450540 outputs/1BL0/decoy_39.pdb
47 -216.097802 14.698302 outputs/1BL0/decoy_8.pdb
15 -237.380327 14.769600 outputs/1BL0/decoy_23.pdb
20 -227.103617 14.789675 outputs/1BL0/decoy_28.pdb
22 -224.993621 14.824303 outputs/1BL0/decoy_3.pdb
6 -234.017388 14.828659 outputs/1BL0/decoy_15.pdb
3 -170.188546 15.114747 outputs/1BL0/decoy_12.pdb
11 -238.737652 15.119295 outputs/1BL0/decoy_2.pdb
29 -251.014512 15.257163 outputs/1BL0/decoy_36.pdb
1 -207.680267 15.356733 outputs/1BL0/decoy_10.pdb
38 -222.745825 15.682537 outputs/1BL0/decoy_44.pdb
27 -213.020400 16.020756 outputs/1BL0/decoy_34.pdb
25 -239.552129 16.586015 outputs/1BL0/decoy_32.pdb
30 -194.486243 17.104551 outputs/1BL0/decoy_37.pdb
9 -222.297438 18.210039 outputs/1BL0/decoy_18.pdb
8 -250.200669 19.318998 outputs/1BL0/decoy_17.pdb
43 -221.472382 19.370868 outputs/1BL0/decoy_49.pdb

Q: Plot the energy_score VS rmsd. Are the lowest energy structures the closest to the native one?

In [126]:
plt.plot(rmsd_df.energy_score, rmsd_df.rmsd, 'o', color='black');
plt.xlabel("energy_score")
plt.ylabel("rmsd")
Out[126]:
Text(0, 0.5, 'rmsd')
In [ ]:
If I have understood right, being closer to the native one would mean a rmsd close to 1.
Regardless, the lower energy score ones DO NOT seem any closer to 1 
and so are not closer to the native one.